SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR3428C from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3428C
Domain Number 1 Region: 33-200
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-34
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 
Domain Number 2 Region: 225-302
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000131
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000262
Family DBL homology domain (DH-domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR3428C
Sequence length 304
Comment $ NESG $ SQ102150 $ PDBT137233 $
Sequence
AERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDG
ELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKS
HGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYT
FDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPK
MVAVQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPC
PVDG
Download sequence
Identical sequences HR3428C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]