SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR3588B from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3588B
Domain Number 1 Region: 220-362
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-39
Family DBL homology domain (DH-domain) 0.00000134
Further Details:      
 
Weak hits

Sequence:  HR3588B
Domain Number - Region: 7-97
Classification Level Classification E-value
Superfamily Spectrin repeat 0.013
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR3588B
Sequence length 362
Comment $ NESG $ SQ102667 $ PDBT137552 $
Sequence
AQFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQA
RQCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSP
ELKVQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQ
GKKTWRQNQSNLKIEVVPDCQEKRSSGPSSSLDNGNSLDVLKNHVLNELIQTERVYVREL
YTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIFLSSLENCAHAPERV
GPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQR
IT
Download sequence
Identical sequences HR3588B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]