SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR3605A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3605A
Domain Number 1 Region: 16-169
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-44
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR3605A
Sequence length 170
Comment $ NESG $ SQ102700 $ PDBT136697 $
Sequence
IPVPLMERQESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFP
ADVVHGIFSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNF
DRAVELVNTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYE
Download sequence
Identical sequences HR3605A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]