SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR3634B from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3634B
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-39
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 174-234
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000424
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR3634B
Sequence length 252
Comment $ NESG $ SQ102778 $ PDBT136620 $
Sequence
TTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVY
RAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVT
RSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLK
DSFMVELVEGARKLRHVFLFTELLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELE
AVPNIPLVPDEE
Download sequence
Identical sequences HR3634B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]