SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR4456A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR4456A
Domain Number 1 Region: 2-223
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-60
Family DBL homology domain (DH-domain) 0.000000704
Further Details:      
 
Domain Number 2 Region: 224-267
Classification Level Classification E-value
Superfamily PH domain-like 0.000000922
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR4456A
Sequence length 267
Comment $ NESG $ SQ103044 $ PDBT136358 $
Sequence
VPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIF
PSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSF
ALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEE
PTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNL
DITKKKLVHEGPLTWRVTKDKAVEVHV
Download sequence
Identical sequences HR4456A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]