SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR4495F from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR4495F
Domain Number 1 Region: 261-462
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-51
Family DBL homology domain (DH-domain) 0.00000000319
Further Details:      
 
Domain Number 2 Region: 454-578
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-36
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 186-257
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-25
Family SH3-domain 0.0000378
Further Details:      
 
Domain Number 4 Region: 2-147
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-22
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR4495F
Sequence length 583
Comment $ NESG $ SQ252826 $ PDBT140826 $
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNV
TYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVG
Download sequence
Identical sequences HR4495F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]