SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR4593I from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR4593I
Domain Number 1 Region: 5-82
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.28e-18
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR4593I
Sequence length 88
Comment $ NESG $ SQ216629 $ PDBT166207 $
Sequence
FGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYNEIEYAQAAV
KETKGRKIGGNKIKVDFANRESQLAFYH
Download sequence
Identical sequences HR4593I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]