SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR4681A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR4681A
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-30
Family Canonical RBD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HR4681A
Sequence length 93
Comment $ NESG $ SQ103449 $ PDBT135959 $
Sequence
QNHFHVFVGDLSPQITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAEN
AIQQMGGQWLGGRQIRTNWATRKPPAPKSTYES
Download sequence
Identical sequences HR4681A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]