SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K12G11.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K12G11.1
Domain Number 1 Region: 565-593,644-720
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.03e-18
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K12G11.1
Sequence length 749
Comment $ SECSG $ SQ42870 $ PDBT12122 $
Sequence
MAPPGRINHARHLSEAEEEAENYLEHFYNKSEPNKRRVSFVQRGAMNQAQFDEKFDYNKP
HLENELKKQAKKFVRRFYEPFTSFFALKLFIFDLIPILKWFPEYKWKTDLSLDIIGGITV
GVMQVPQGIAYALLAKQPAINGLYTSLFPPLIYMLFGTSRHASLGTFAVVSLMTGLSVEK
LAAPTDYDPSSFNETDIDLVKLPSPTEVSCAITITMGLILFVMGVLRLQFLTTYLSDQVI
AGFTVGSSVHVLVSQLKTLLGIRGLPRHSGPFYLFRHLYDLVMSITRANPVSCGISIVSI
IVLHFGKEFINPFIKRKTKSNIPIPWELVIVILSTVFVAVTGVDTEAKVQVVNKIPVGVP
NFSLPSFYLIPQVLPDAISITVVSISVWLSISKMLAKRYNYELDSGQELFALSFASISSS
FIPSIPNSCSLSRTLVAVGAGCTTQLSIFFSSLIVFSVVIFLGTLLETLPMAALSAIICV
ALQGMFRKFADLIDLWKVSKIDFTIWVVSCVSTILLDVSTGLIISVCFALFTTILREQYP
KWHLLASVKGTQDFRDAERYGETVYFKGICIFRFDAPLLFHNVECFKKSIEKAYTEWQKS
HEFYVLREERETILNTKLDGSDESIDGKMFQTAQSTLNTHSPDILSRHFVIDCSGFTFID
LMGVSALKEIFSDMRKRGILVYFANAKAPVREMFEKCHFFNFVSKENFYPTMRDATSIAR
QRQLELGFKDTGYVPEHDRLTEVLSSHPM
Download sequence
Identical sequences G5EEA7
NP_505989.1.50509 6239.K12G11.1 K12G11.1 K12G11.1 K12G11.1 K12G11.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]