SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Lmaj006903AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Lmaj006903AAA
Domain Number - Region: 10-70
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00245
Family Canonical RBD 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lmaj006903AAA
Sequence length 162
Comment $ SGPP $ SQ58975 $ PDBT216376 $
Sequence
MAHHHHHHMYVDVPTAEDTRRVVAALNNMMIGEVRVLVQISTLVRKRERSPQRVRDAPRR
GGDRHERDSHHHRRRSDSREGRRRHHRSRRSYTPSSRSTSSYSSRSRSHSRGRRSYSPDS
EDSRDRRSRRGGYHGSDRRRGGRAERGSDRRERRGDERRTRR
Download sequence
Identical sequences Lmaj006903AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]