SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Lmaj012696AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Lmaj012696AAA
Domain Number 1 Region: 303-599
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.01e-97
Family Mammalian PLC 0.00000249
Further Details:      
 
Domain Number 2 Region: 167-292
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000111
Family EF-hand modules in multidomain proteins 0.056
Further Details:      
 
Domain Number 3 Region: 610-730
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000573
Family PLC-like (P variant) 0.018
Further Details:      
 
Weak hits

Sequence:  Lmaj012696AAA
Domain Number - Region: 102-145
Classification Level Classification E-value
Superfamily PH domain-like 0.00117
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number - Region: 3-55
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0412
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Lmaj012696AAA
Sequence length 737
Comment $ SGPP $ SQ69126 $ PDBT227192 $
Sequence
MAHHHHHHMSLTLTEVNSWDSSLERKCTELADELKEKGVSLLRVTRSYKVKKVLISFSPL
GDGLQYQPASKHHSSLLFADMWAIQSLPPSHKICSKAGLKHFQYCFQVESQFGWSWNLVC
NTALERSTWVDFLEQHRRTFLDKSRANAANASVERYWFIAAQQGKTKLSFTEISMLTNKL
FGRVPAAELADRFRQCDSDKDTCLNYQEFCEFFRYFNEAKAVRSIYERHTSECAPGMTAE
EFTRFCISNDAAATVTPMRCASLFHLFANRQSDRMALSGFTAFLLHPHHNSIVDARQLRL
TDSMDHPLPHYFINSSHNTYLTGNQLNSESSCNMYRDVLLAGCRCVEIDCWDGPAGVPVV
YHGHTMTTKIAFDDVVRTINDYAFQNPSNNQEAAWNPRELPVIVSLEVHTSPEQTNRMAE
IIRSVFKERLFLSRLDASSYTPAKLKGKILVKWKMNAAGVEDLKDTAGSGIRADRRAPLL
TTLSLSACASIGTVRSTSWGAEEQPFHVQSYVEGEVARLEACSPVDFARQNTHMLSRIYP
SGTRIDSSNYDPMLMWRLGCQLVALNWQTRDHNFRVNEGFFTHQNGGCGYVLKPMYLRDV
DAGCSAVPFTLALRLICGSHLSTTFDGADATHVTLRLRVHGEAWSHETIAVPTTIYPEWN
ESMELQGKCKETAVLCLCVVAHTRSGATHDVCTACLPVRVLRTGYHAMPLRHVKSGRTAE
VASVLCHFSFKTPTLFS
Download sequence
Identical sequences Lmaj012696AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]