SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MyavA.17065.a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MyavA.17065.a
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.79e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MyavA.17065.a
Sequence length 113
Comment $ SSGCID $ SQ230226 $ PDBT344849 $
Sequence
MVEDHDGVSVVSVSGEIDLVTAPALEQAIGAVVADSPPALVIDLSAVEFLGSVGLKILAA
TYEKLGKETGFGVVARGPATRRPIHLTGLDKTFPLYPTLDDALTAVRDGKLNG
Download sequence
Identical sequences A0A0E2WIS3 A0A0H2ZRP9 A0A1X0BWL1 A0A2A2ZPK3 A0A2A3L6D2 X8BBQ1
WP_003877048.1.100504 WP_003877048.1.101159 WP_003877048.1.12505 WP_003877048.1.12954 WP_003877048.1.1369 WP_003877048.1.14373 WP_003877048.1.14691 WP_003877048.1.14707 WP_003877048.1.1472 WP_003877048.1.14816 WP_003877048.1.15384 WP_003877048.1.15663 WP_003877048.1.1614 WP_003877048.1.16293 WP_003877048.1.16945 WP_003877048.1.17266 WP_003877048.1.17321 WP_003877048.1.17624 WP_003877048.1.17884 WP_003877048.1.17915 WP_003877048.1.18785 WP_003877048.1.1994 WP_003877048.1.20882 WP_003877048.1.21325 WP_003877048.1.22278 WP_003877048.1.22600 WP_003877048.1.23768 WP_003877048.1.2690 WP_003877048.1.27647 WP_003877048.1.28864 WP_003877048.1.29527 WP_003877048.1.31474 WP_003877048.1.32203 WP_003877048.1.32247 WP_003877048.1.33234 WP_003877048.1.3468 WP_003877048.1.34688 WP_003877048.1.35384 WP_003877048.1.35500 WP_003877048.1.35510 WP_003877048.1.36073 WP_003877048.1.38978 WP_003877048.1.39409 WP_003877048.1.3962 WP_003877048.1.40244 WP_003877048.1.42004 WP_003877048.1.42052 WP_003877048.1.42684 WP_003877048.1.44666 WP_003877048.1.4542 WP_003877048.1.45459 WP_003877048.1.47364 WP_003877048.1.4754 WP_003877048.1.48008 WP_003877048.1.49379 WP_003877048.1.50439 WP_003877048.1.50890 WP_003877048.1.51803 WP_003877048.1.52934 WP_003877048.1.53280 WP_003877048.1.53771 WP_003877048.1.54538 WP_003877048.1.55522 WP_003877048.1.55781 WP_003877048.1.55945 WP_003877048.1.56146 WP_003877048.1.56366 WP_003877048.1.56924 WP_003877048.1.57680 WP_003877048.1.58557 WP_003877048.1.59206 WP_003877048.1.60164 WP_003877048.1.61195 WP_003877048.1.62105 WP_003877048.1.6247 WP_003877048.1.62782 WP_003877048.1.62963 WP_003877048.1.63545 WP_003877048.1.6371 WP_003877048.1.64277 WP_003877048.1.646 WP_003877048.1.64827 WP_003877048.1.64833 WP_003877048.1.65121 WP_003877048.1.65674 WP_003877048.1.65884 WP_003877048.1.66097 WP_003877048.1.66499 WP_003877048.1.66967 WP_003877048.1.67083 WP_003877048.1.67285 WP_003877048.1.68982 WP_003877048.1.69393 WP_003877048.1.70933 WP_003877048.1.7097 WP_003877048.1.72172 WP_003877048.1.74476 WP_003877048.1.74562 WP_003877048.1.7463 WP_003877048.1.74957 WP_003877048.1.75695 WP_003877048.1.75798 WP_003877048.1.76287 WP_003877048.1.78536 WP_003877048.1.7926 WP_003877048.1.80001 WP_003877048.1.80920 WP_003877048.1.81559 WP_003877048.1.8174 WP_003877048.1.82097 WP_003877048.1.83808 WP_003877048.1.84212 WP_003877048.1.85628 WP_003877048.1.86358 WP_003877048.1.87305 WP_003877048.1.87519 WP_003877048.1.87736 WP_003877048.1.8774 WP_003877048.1.88396 WP_003877048.1.88567 WP_003877048.1.92407 WP_003877048.1.93735 WP_003877048.1.93753 WP_003877048.1.94747 WP_003877048.1.95123 WP_003877048.1.95627 WP_003877048.1.96060 WP_003877048.1.9734 WP_003877048.1.98356 WP_003877048.1.98724 WP_003877048.1.98895 WP_003877048.1.99050 WP_003877048.1.9971 MyavA.17065.a gi|118462796|ref|YP_879719.1| 243243.MAV_0435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]