SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MytuD.17065.a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MytuD.17065.a
Domain Number 1 Region: 19-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.44e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MytuD.17065.a
Sequence length 128
Comment $ SSGCID $ SQ212454 $ PDBT344956 $
Sequence
MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEP
LVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPT
TESALSAT
Download sequence
Identical sequences A0A045J2D3 A0A0H3LF38 A5U266 G0TIH1 I6XBB8 P9WGE2 P9WGE3 R4M526 R4MHE0
gi|15840823|ref|NP_335860.1| MytuD.17065.a gi|385990789|ref|YP_005909087.1| gi|392386056|ref|YP_005307685.1| 336982.TBFG_11396 419947.MRA_1374 478434.TBMG_02613 83331.MT1411 83332.Rv1365c NP_215881.1.84033 WP_003898845.1.100000 WP_003898845.1.100021 WP_003898845.1.100069 WP_003898845.1.100087 WP_003898845.1.10015 WP_003898845.1.100208 WP_003898845.1.100216 WP_003898845.1.10022 WP_003898845.1.100255 WP_003898845.1.100260 WP_003898845.1.100270 WP_003898845.1.100279 WP_003898845.1.100286 WP_003898845.1.100308 WP_003898845.1.100309 WP_003898845.1.100318 WP_003898845.1.100338 WP_003898845.1.10037 WP_003898845.1.100383 WP_003898845.1.100396 WP_003898845.1.1004 WP_003898845.1.100401 WP_003898845.1.100459 WP_003898845.1.100460 WP_003898845.1.100552 WP_003898845.1.100581 WP_003898845.1.100600 WP_003898845.1.100625 WP_003898845.1.10064 WP_003898845.1.100666 WP_003898845.1.100671 WP_003898845.1.100677 WP_003898845.1.100697 WP_003898845.1.100703 WP_003898845.1.100716 WP_003898845.1.100722 WP_003898845.1.100754 WP_003898845.1.100757 WP_003898845.1.100772 WP_003898845.1.1008 WP_003898845.1.100812 WP_003898845.1.100845 WP_003898845.1.100866 WP_003898845.1.10088 WP_003898845.1.100889 WP_003898845.1.10090 WP_003898845.1.100910 WP_003898845.1.100915 WP_003898845.1.100918 WP_003898845.1.100935 WP_003898845.1.100984 WP_003898845.1.100992 WP_003898845.1.100998 WP_003898845.1.101 WP_003898845.1.101025 WP_003898845.1.101028 WP_003898845.1.10104 WP_003898845.1.101048 WP_003898845.1.101054 WP_003898845.1.101075 WP_003898845.1.101143 WP_003898845.1.10116 WP_003898845.1.10117 WP_003898845.1.101209 WP_003898845.1.10125 WP_003898845.1.101290 WP_003898845.1.101323 WP_003898845.1.101324 WP_003898845.1.101350 WP_003898845.1.101367 WP_003898845.1.101398 WP_003898845.1.101403 WP_003898845.1.101421 WP_003898845.1.10144 WP_003898845.1.101442 WP_003898845.1.10145 WP_003898845.1.101452 WP_003898845.1.101456 WP_003898845.1.101481 WP_003898845.1.101493 WP_003898845.1.101496 WP_003898845.1.101525 WP_003898845.1.101533 WP_003898845.1.101535 WP_003898845.1.101553 WP_003898845.1.101558 WP_003898845.1.10156 WP_003898845.1.101573 WP_003898845.1.101576 WP_003898845.1.10159 WP_003898845.1.101592 WP_003898845.1.101604 WP_003898845.1.101607 WP_003898845.1.101622 WP_003898845.1.101644 WP_003898845.1.101659 WP_003898845.1.101671 WP_003898845.1.101687 WP_003898845.1.101698 WP_003898845.1.10170 WP_003898845.1.101713 WP_003898845.1.101722 WP_003898845.1.101733 WP_003898845.1.101743 WP_003898845.1.101753 WP_003898845.1.101754 WP_003898845.1.101764 WP_003898845.1.101773 WP_003898845.1.101795 WP_003898845.1.101797 WP_003898845.1.101798 WP_003898845.1.101802 WP_003898845.1.101826 WP_003898845.1.101836 WP_003898845.1.101858 WP_003898845.1.101859 WP_003898845.1.101862 WP_003898845.1.101888 WP_003898845.1.101894 WP_003898845.1.101899 WP_003898845.1.1019 WP_003898845.1.101923 WP_003898845.1.101925 WP_003898845.1.10193 WP_003898845.1.102 WP_003898845.1.102008 WP_003898845.1.102017 WP_003898845.1.102053 WP_003898845.1.102055 WP_003898845.1.102063 WP_003898845.1.102099 WP_003898845.1.1021 WP_003898845.1.10211 WP_003898845.1.102119 WP_003898845.1.102121 WP_003898845.1.102143 WP_003898845.1.10216 WP_003898845.1.10224 WP_003898845.1.10253 WP_003898845.1.10262 WP_003898845.1.10272 WP_003898845.1.10277 WP_003898845.1.1033 WP_003898845.1.10350 WP_003898845.1.10362 WP_003898845.1.10366 WP_003898845.1.10376 WP_003898845.1.10396 WP_003898845.1.10410 WP_003898845.1.10414 WP_003898845.1.10430 WP_003898845.1.1044 WP_003898845.1.10440 WP_003898845.1.10471 WP_003898845.1.10472 WP_003898845.1.10489 WP_003898845.1.105 WP_003898845.1.10518 WP_003898845.1.10523 WP_003898845.1.10545 WP_003898845.1.1057 WP_003898845.1.10594 WP_003898845.1.10603 WP_003898845.1.10606 WP_003898845.1.10615 WP_003898845.1.10623 WP_003898845.1.10635 WP_003898845.1.10643 WP_003898845.1.10648 WP_003898845.1.10662 WP_003898845.1.10709 WP_003898845.1.10735 WP_003898845.1.10740 WP_003898845.1.10756 WP_003898845.1.1078 WP_003898845.1.10791 WP_003898845.1.10799 WP_003898845.1.10825 WP_003898845.1.10848 WP_003898845.1.10863 WP_003898845.1.10879 WP_003898845.1.10912 WP_003898845.1.10916 WP_003898845.1.10923 WP_003898845.1.10927 WP_003898845.1.1095 WP_003898845.1.10956 WP_003898845.1.10958 WP_003898845.1.10962 WP_003898845.1.10980 WP_003898845.1.10981 WP_003898845.1.10993 WP_003898845.1.1100 WP_003898845.1.11040 WP_003898845.1.11061 WP_003898845.1.11070 WP_003898845.1.11171 WP_003898845.1.11175 WP_003898845.1.11176 WP_003898845.1.11222 WP_003898845.1.11236 WP_003898845.1.11329 WP_003898845.1.1133 WP_003898845.1.11342 WP_003898845.1.11373 WP_003898845.1.11376 WP_003898845.1.11390 WP_003898845.1.11402 WP_003898845.1.11481 WP_003898845.1.11487 WP_003898845.1.11489 WP_003898845.1.11514 WP_003898845.1.11589 WP_003898845.1.11596 WP_003898845.1.11604 WP_003898845.1.11610 WP_003898845.1.11697 WP_003898845.1.11707 WP_003898845.1.11752 WP_003898845.1.11758 WP_003898845.1.11761 WP_003898845.1.11775 WP_003898845.1.11804 WP_003898845.1.11822 WP_003898845.1.11826 WP_003898845.1.11856 WP_003898845.1.11898 WP_003898845.1.11906 WP_003898845.1.11939 WP_003898845.1.11960 WP_003898845.1.11961 WP_003898845.1.11972 WP_003898845.1.11984 WP_003898845.1.120 WP_003898845.1.12001 WP_003898845.1.12049 WP_003898845.1.12052 WP_003898845.1.12100 WP_003898845.1.12116 WP_003898845.1.12133 WP_003898845.1.12161 WP_003898845.1.12165 WP_003898845.1.12184 WP_003898845.1.12190 WP_003898845.1.12216 WP_003898845.1.12265 WP_003898845.1.12275 WP_003898845.1.12293 WP_003898845.1.12294 WP_003898845.1.123 WP_003898845.1.1231 WP_003898845.1.12314 WP_003898845.1.12327 WP_003898845.1.12338 WP_003898845.1.1236 WP_003898845.1.12371 WP_003898845.1.12372 WP_003898845.1.12389 WP_003898845.1.12406 WP_003898845.1.1241 WP_003898845.1.12421 WP_003898845.1.12446 WP_003898845.1.12464 WP_003898845.1.12479 WP_003898845.1.12519 WP_003898845.1.12523 WP_003898845.1.12526 WP_003898845.1.1255 WP_003898845.1.12550 WP_003898845.1.12551 WP_003898845.1.12563 WP_003898845.1.12611 WP_003898845.1.12669 WP_003898845.1.1267 WP_003898845.1.12672 WP_003898845.1.12692 WP_003898845.1.1271 WP_003898845.1.12768 WP_003898845.1.1279 WP_003898845.1.12794 WP_003898845.1.12804 WP_003898845.1.12821 WP_003898845.1.12841 WP_003898845.1.12854 WP_003898845.1.12871 WP_003898845.1.12901 WP_003898845.1.12941 WP_003898845.1.12947 WP_003898845.1.12957 WP_003898845.1.12972 WP_003898845.1.13028 WP_003898845.1.13043 WP_003898845.1.13086 WP_003898845.1.13087 WP_003898845.1.13090 WP_003898845.1.13096 WP_003898845.1.13163 WP_003898845.1.13175 WP_003898845.1.13183 WP_003898845.1.132 WP_003898845.1.13249 WP_003898845.1.13282 WP_003898845.1.13284 WP_003898845.1.13296 WP_003898845.1.13298 WP_003898845.1.13306 WP_003898845.1.13312 WP_003898845.1.13313 WP_003898845.1.13321 WP_003898845.1.13345 WP_003898845.1.13358 WP_003898845.1.13370 WP_003898845.1.13375 WP_003898845.1.1338 WP_003898845.1.13420 WP_003898845.1.13433 WP_003898845.1.13435 WP_003898845.1.13438 WP_003898845.1.13461 WP_003898845.1.13466 WP_003898845.1.13489 WP_003898845.1.13551 WP_003898845.1.13561 WP_003898845.1.13564 WP_003898845.1.13579 WP_003898845.1.13647 WP_003898845.1.13687 WP_003898845.1.13697 WP_003898845.1.13719 WP_003898845.1.13763 WP_003898845.1.1377 WP_003898845.1.13774 WP_003898845.1.13786 WP_003898845.1.13793 WP_003898845.1.13794 WP_003898845.1.13817 WP_003898845.1.13834 WP_003898845.1.13866 WP_003898845.1.13880 WP_003898845.1.13899 WP_003898845.1.13909 WP_003898845.1.13910 WP_003898845.1.13919 WP_003898845.1.13920 WP_003898845.1.13952 WP_003898845.1.13953 WP_003898845.1.13962 WP_003898845.1.1398 WP_003898845.1.13988 WP_003898845.1.14027 WP_003898845.1.14046 WP_003898845.1.14115 WP_003898845.1.1415 WP_003898845.1.14152 WP_003898845.1.14158 WP_003898845.1.14162 WP_003898845.1.14175 WP_003898845.1.14178 WP_003898845.1.14194 WP_003898845.1.14195 WP_003898845.1.14208 WP_003898845.1.14238 WP_003898845.1.14266 WP_003898845.1.14273 WP_003898845.1.14303 WP_003898845.1.14306 WP_003898845.1.14307 WP_003898845.1.14310 WP_003898845.1.14382 WP_003898845.1.14416 WP_003898845.1.14428 WP_003898845.1.14441 WP_003898845.1.14469 WP_003898845.1.14477 WP_003898845.1.14504 WP_003898845.1.14514 WP_003898845.1.1452 WP_003898845.1.14527 WP_003898845.1.1454 WP_003898845.1.14544 WP_003898845.1.14548 WP_003898845.1.14551 WP_003898845.1.14561 WP_003898845.1.14573 WP_003898845.1.1462 WP_003898845.1.14667 WP_003898845.1.14668 WP_003898845.1.14675 WP_003898845.1.14694 WP_003898845.1.14695 WP_003898845.1.14709 WP_003898845.1.14766 WP_003898845.1.14783 WP_003898845.1.14865 WP_003898845.1.14872 WP_003898845.1.14905 WP_003898845.1.14926 WP_003898845.1.14951 WP_003898845.1.14955 WP_003898845.1.15003 WP_003898845.1.15009 WP_003898845.1.15028 WP_003898845.1.15040 WP_003898845.1.15052 WP_003898845.1.15065 WP_003898845.1.15072 WP_003898845.1.15089 WP_003898845.1.1509 WP_003898845.1.15126 WP_003898845.1.15131 WP_003898845.1.15168 WP_003898845.1.15174 WP_003898845.1.15187 WP_003898845.1.15196 WP_003898845.1.15210 WP_003898845.1.15216 WP_003898845.1.15217 WP_003898845.1.1523 WP_003898845.1.15232 WP_003898845.1.15238 WP_003898845.1.15240 WP_003898845.1.15253 WP_003898845.1.15267 WP_003898845.1.1527 WP_003898845.1.15292 WP_003898845.1.15299 WP_003898845.1.15302 WP_003898845.1.15322 WP_003898845.1.1534 WP_003898845.1.15365 WP_003898845.1.15386 WP_003898845.1.15387 WP_003898845.1.15442 WP_003898845.1.15447 WP_003898845.1.15449 WP_003898845.1.15477 WP_003898845.1.15481 WP_003898845.1.15492 WP_003898845.1.15511 WP_003898845.1.15512 WP_003898845.1.15558 WP_003898845.1.15559 WP_003898845.1.15566 WP_003898845.1.15599 WP_003898845.1.1560 WP_003898845.1.15611 WP_003898845.1.1563 WP_003898845.1.15633 WP_003898845.1.15643 WP_003898845.1.15688 WP_003898845.1.15755 WP_003898845.1.15763 WP_003898845.1.15774 WP_003898845.1.1578 WP_003898845.1.15780 WP_003898845.1.15834 WP_003898845.1.15842 WP_003898845.1.15848 WP_003898845.1.15853 WP_003898845.1.15870 WP_003898845.1.15877 WP_003898845.1.15893 WP_003898845.1.15896 WP_003898845.1.15926 WP_003898845.1.15933 WP_003898845.1.15946 WP_003898845.1.15958 WP_003898845.1.15973 WP_003898845.1.15987 WP_003898845.1.15993 WP_003898845.1.16009 WP_003898845.1.16025 WP_003898845.1.16043 WP_003898845.1.16055 WP_003898845.1.16066 WP_003898845.1.16069 WP_003898845.1.16077 WP_003898845.1.16106 WP_003898845.1.16108 WP_003898845.1.16130 WP_003898845.1.16136 WP_003898845.1.16139 WP_003898845.1.16141 WP_003898845.1.16143 WP_003898845.1.1630 WP_003898845.1.16318 WP_003898845.1.1632 WP_003898845.1.16327 WP_003898845.1.16334 WP_003898845.1.16341 WP_003898845.1.16345 WP_003898845.1.16374 WP_003898845.1.16384 WP_003898845.1.16386 WP_003898845.1.164 WP_003898845.1.1642 WP_003898845.1.16424 WP_003898845.1.16426 WP_003898845.1.16431 WP_003898845.1.16438 WP_003898845.1.1644 WP_003898845.1.16442 WP_003898845.1.16448 WP_003898845.1.16451 WP_003898845.1.16476 WP_003898845.1.16480 WP_003898845.1.16494 WP_003898845.1.1652 WP_003898845.1.16549 WP_003898845.1.16560 WP_003898845.1.16598 WP_003898845.1.16609 WP_003898845.1.16619 WP_003898845.1.16620 WP_003898845.1.16622 WP_003898845.1.16637 WP_003898845.1.1669 WP_003898845.1.16707 WP_003898845.1.16724 WP_003898845.1.16731 WP_003898845.1.16743 WP_003898845.1.16837 WP_003898845.1.16852 WP_003898845.1.16937 WP_003898845.1.16940 WP_003898845.1.16950 WP_003898845.1.16959 WP_003898845.1.16968 WP_003898845.1.1697 WP_003898845.1.16977 WP_003898845.1.16987 WP_003898845.1.17005 WP_003898845.1.17006 WP_003898845.1.17010 WP_003898845.1.17015 WP_003898845.1.17019 WP_003898845.1.17041 WP_003898845.1.17052 WP_003898845.1.17057 WP_003898845.1.17062 WP_003898845.1.1707 WP_003898845.1.17094 WP_003898845.1.17130 WP_003898845.1.17138 WP_003898845.1.17147 WP_003898845.1.17224 WP_003898845.1.17251 WP_003898845.1.17288 WP_003898845.1.17304 WP_003898845.1.17345 WP_003898845.1.17381 WP_003898845.1.17391 WP_003898845.1.17412 WP_003898845.1.1743 WP_003898845.1.17440 WP_003898845.1.17466 WP_003898845.1.17477 WP_003898845.1.17483 WP_003898845.1.17505 WP_003898845.1.17527 WP_003898845.1.17535 WP_003898845.1.17540 WP_003898845.1.17553 WP_003898845.1.17558 WP_003898845.1.17599 WP_003898845.1.17635 WP_003898845.1.17655 WP_003898845.1.17679 WP_003898845.1.17687 WP_003898845.1.17700 WP_003898845.1.17710 WP_003898845.1.17713 WP_003898845.1.17722 WP_003898845.1.17746 WP_003898845.1.17788 WP_003898845.1.17798 WP_003898845.1.17803 WP_003898845.1.17816 WP_003898845.1.17821 WP_003898845.1.17830 WP_003898845.1.17868 WP_003898845.1.17878 WP_003898845.1.1792 WP_003898845.1.17923 WP_003898845.1.1795 WP_003898845.1.17955 WP_003898845.1.17973 WP_003898845.1.18009 WP_003898845.1.18033 WP_003898845.1.18057 WP_003898845.1.18065 WP_003898845.1.18070 WP_003898845.1.18116 WP_003898845.1.18120 WP_003898845.1.18126 WP_003898845.1.1817 WP_003898845.1.18170 WP_003898845.1.18206 WP_003898845.1.18216 WP_003898845.1.18240 WP_003898845.1.18257 WP_003898845.1.18297 WP_003898845.1.18306 WP_003898845.1.18364 WP_003898845.1.18399 WP_003898845.1.18411 WP_003898845.1.18444 WP_003898845.1.18448 WP_003898845.1.18467 WP_003898845.1.18476 WP_003898845.1.18522 WP_003898845.1.18580 WP_003898845.1.18582 WP_003898845.1.18587 WP_003898845.1.186 WP_003898845.1.18601 WP_003898845.1.18639 WP_003898845.1.18646 WP_003898845.1.18647 WP_003898845.1.1868 WP_003898845.1.18694 WP_003898845.1.18710 WP_003898845.1.18751 WP_003898845.1.18781 WP_003898845.1.18793 WP_003898845.1.18804 WP_003898845.1.18816 WP_003898845.1.18823 WP_003898845.1.18827 WP_003898845.1.18838 WP_003898845.1.18849 WP_003898845.1.18856 WP_003898845.1.18945 WP_003898845.1.1898 WP_003898845.1.19005 WP_003898845.1.19056 WP_003898845.1.19066 WP_003898845.1.19071 WP_003898845.1.19085 WP_003898845.1.19094 WP_003898845.1.19144 WP_003898845.1.19159 WP_003898845.1.19193 WP_003898845.1.19231 WP_003898845.1.19243 WP_003898845.1.19264 WP_003898845.1.19295 WP_003898845.1.19326 WP_003898845.1.1933 WP_003898845.1.19364 WP_003898845.1.19382 WP_003898845.1.19400 WP_003898845.1.19426 WP_003898845.1.19429 WP_003898845.1.19464 WP_003898845.1.19480 WP_003898845.1.19553 WP_003898845.1.19562 WP_003898845.1.19564 WP_003898845.1.19568 WP_003898845.1.19572 WP_003898845.1.19595 WP_003898845.1.19596 WP_003898845.1.19600 WP_003898845.1.19630 WP_003898845.1.1967 WP_003898845.1.19694 WP_003898845.1.1970 WP_003898845.1.19707 WP_003898845.1.19742 WP_003898845.1.19785 WP_003898845.1.19820 WP_003898845.1.19868 WP_003898845.1.19874 WP_003898845.1.19890 WP_003898845.1.19900 WP_003898845.1.19922 WP_003898845.1.19936 WP_003898845.1.19946 WP_003898845.1.19949 WP_003898845.1.19960 WP_003898845.1.19964 WP_003898845.1.20007 WP_003898845.1.20016 WP_003898845.1.2003 WP_003898845.1.20037 WP_003898845.1.20039 WP_003898845.1.20082 WP_003898845.1.20085 WP_003898845.1.20097 WP_003898845.1.20116 WP_003898845.1.20130 WP_003898845.1.20140 WP_003898845.1.20141 WP_003898845.1.20142 WP_003898845.1.20158 WP_003898845.1.20239 WP_003898845.1.20243 WP_003898845.1.20259 WP_003898845.1.20262 WP_003898845.1.20272 WP_003898845.1.20280 WP_003898845.1.20294 WP_003898845.1.20300 WP_003898845.1.20309 WP_003898845.1.20322 WP_003898845.1.2037 WP_003898845.1.20372 WP_003898845.1.20381 WP_003898845.1.204 WP_003898845.1.20427 WP_003898845.1.20457 WP_003898845.1.20459 WP_003898845.1.20460 WP_003898845.1.20542 WP_003898845.1.20578 WP_003898845.1.20608 WP_003898845.1.20624 WP_003898845.1.20628 WP_003898845.1.2066 WP_003898845.1.20707 WP_003898845.1.20722 WP_003898845.1.20729 WP_003898845.1.20742 WP_003898845.1.20751 WP_003898845.1.20776 WP_003898845.1.20843 WP_003898845.1.20850 WP_003898845.1.2086 WP_003898845.1.20868 WP_003898845.1.20876 WP_003898845.1.20897 WP_003898845.1.20898 WP_003898845.1.2090 WP_003898845.1.20911 WP_003898845.1.20921 WP_003898845.1.20926 WP_003898845.1.20927 WP_003898845.1.20951 WP_003898845.1.20970 WP_003898845.1.2104 WP_003898845.1.21070 WP_003898845.1.21127 WP_003898845.1.21135 WP_003898845.1.21173 WP_003898845.1.21187 WP_003898845.1.212 WP_003898845.1.2120 WP_003898845.1.21218 WP_003898845.1.21219 WP_003898845.1.2123 WP_003898845.1.21231 WP_003898845.1.21234 WP_003898845.1.2126 WP_003898845.1.21292 WP_003898845.1.21307 WP_003898845.1.2131 WP_003898845.1.21311 WP_003898845.1.21321 WP_003898845.1.21365 WP_003898845.1.21392 WP_003898845.1.21397 WP_003898845.1.21403 WP_003898845.1.21415 WP_003898845.1.21430 WP_003898845.1.21434 WP_003898845.1.21444 WP_003898845.1.21468 WP_003898845.1.21498 WP_003898845.1.21509 WP_003898845.1.21513 WP_003898845.1.21560 WP_003898845.1.21565 WP_003898845.1.21586 WP_003898845.1.21591 WP_003898845.1.21594 WP_003898845.1.21602 WP_003898845.1.21615 WP_003898845.1.21638 WP_003898845.1.21639 WP_003898845.1.21655 WP_003898845.1.21658 WP_003898845.1.2168 WP_003898845.1.2174 WP_003898845.1.21741 WP_003898845.1.21777 WP_003898845.1.21786 WP_003898845.1.21795 WP_003898845.1.218 WP_003898845.1.21826 WP_003898845.1.21829 WP_003898845.1.21840 WP_003898845.1.21843 WP_003898845.1.21872 WP_003898845.1.21873 WP_003898845.1.2188 WP_003898845.1.21882 WP_003898845.1.21906 WP_003898845.1.21912 WP_003898845.1.2194 WP_003898845.1.21941 WP_003898845.1.21956 WP_003898845.1.21958 WP_003898845.1.21960 WP_003898845.1.21971 WP_003898845.1.21973 WP_003898845.1.21983 WP_003898845.1.22003 WP_003898845.1.22013 WP_003898845.1.22025 WP_003898845.1.22036 WP_003898845.1.22075 WP_003898845.1.22092 WP_003898845.1.2212 WP_003898845.1.22127 WP_003898845.1.22140 WP_003898845.1.22233 WP_003898845.1.22255 WP_003898845.1.22277 WP_003898845.1.22305 WP_003898845.1.22348 WP_003898845.1.22356 WP_003898845.1.22366 WP_003898845.1.2238 WP_003898845.1.22380 WP_003898845.1.22437 WP_003898845.1.22438 WP_003898845.1.22445 WP_003898845.1.22511 WP_003898845.1.22524 WP_003898845.1.22585 WP_003898845.1.22589 WP_003898845.1.22606 WP_003898845.1.22608 WP_003898845.1.22609 WP_003898845.1.22618 WP_003898845.1.2262 WP_003898845.1.22624 WP_003898845.1.22629 WP_003898845.1.22647 WP_003898845.1.22664 WP_003898845.1.22665 WP_003898845.1.22670 WP_003898845.1.22725 WP_003898845.1.22728 WP_003898845.1.22733 WP_003898845.1.22737 WP_003898845.1.2275 WP_003898845.1.22754 WP_003898845.1.22800 WP_003898845.1.22804 WP_003898845.1.22829 WP_003898845.1.22840 WP_003898845.1.22844 WP_003898845.1.22970 WP_003898845.1.22996 WP_003898845.1.22997 WP_003898845.1.22999 WP_003898845.1.23015 WP_003898845.1.23032 WP_003898845.1.231 WP_003898845.1.23101 WP_003898845.1.2312 WP_003898845.1.23153 WP_003898845.1.23171 WP_003898845.1.23199 WP_003898845.1.2320 WP_003898845.1.23204 WP_003898845.1.23216 WP_003898845.1.23229 WP_003898845.1.23233 WP_003898845.1.2326 WP_003898845.1.23261 WP_003898845.1.23272 WP_003898845.1.23289 WP_003898845.1.2329 WP_003898845.1.23308 WP_003898845.1.23321 WP_003898845.1.23325 WP_003898845.1.2339 WP_003898845.1.23406 WP_003898845.1.23438 WP_003898845.1.23445 WP_003898845.1.23447 WP_003898845.1.23452 WP_003898845.1.23461 WP_003898845.1.2349 WP_003898845.1.23496 WP_003898845.1.23506 WP_003898845.1.23530 WP_003898845.1.23539 WP_003898845.1.23546 WP_003898845.1.23551 WP_003898845.1.23573 WP_003898845.1.23583 WP_003898845.1.23588 WP_003898845.1.23628 WP_003898845.1.23677 WP_003898845.1.23683 WP_003898845.1.23692 WP_003898845.1.23694 WP_003898845.1.23699 WP_003898845.1.2371 WP_003898845.1.23803 WP_003898845.1.23807 WP_003898845.1.23832 WP_003898845.1.2384 WP_003898845.1.23843 WP_003898845.1.23863 WP_003898845.1.23894 WP_003898845.1.23993 WP_003898845.1.2400 WP_003898845.1.24007 WP_003898845.1.24008 WP_003898845.1.24046 WP_003898845.1.24057 WP_003898845.1.24113 WP_003898845.1.24119 WP_003898845.1.24140 WP_003898845.1.24176 WP_003898845.1.24190 WP_003898845.1.24202 WP_003898845.1.24261 WP_003898845.1.24284 WP_003898845.1.24294 WP_003898845.1.24357 WP_003898845.1.24396 WP_003898845.1.24423 WP_003898845.1.2443 WP_003898845.1.24446 WP_003898845.1.24461 WP_003898845.1.24500 WP_003898845.1.24507 WP_003898845.1.24509 WP_003898845.1.24529 WP_003898845.1.24553 WP_003898845.1.24599 WP_003898845.1.24638 WP_003898845.1.24648 WP_003898845.1.2466 WP_003898845.1.24824 WP_003898845.1.24831 WP_003898845.1.24840 WP_003898845.1.24848 WP_003898845.1.24857 WP_003898845.1.2487 WP_003898845.1.24893 WP_003898845.1.24907 WP_003898845.1.24933 WP_003898845.1.24956 WP_003898845.1.24958 WP_003898845.1.24985 WP_003898845.1.2499 WP_003898845.1.25004 WP_003898845.1.2505 WP_003898845.1.25051 WP_003898845.1.2507 WP_003898845.1.25096 WP_003898845.1.25103 WP_003898845.1.25129 WP_003898845.1.25171 WP_003898845.1.25184 WP_003898845.1.25247 WP_003898845.1.25278 WP_003898845.1.25309 WP_003898845.1.25313 WP_003898845.1.25338 WP_003898845.1.25342 WP_003898845.1.25343 WP_003898845.1.25367 WP_003898845.1.25393 WP_003898845.1.25406 WP_003898845.1.25435 WP_003898845.1.25437 WP_003898845.1.25445 WP_003898845.1.25455 WP_003898845.1.25473 WP_003898845.1.25504 WP_003898845.1.25513 WP_003898845.1.25542 WP_003898845.1.25579 WP_003898845.1.25594 WP_003898845.1.25606 WP_003898845.1.25645 WP_003898845.1.2566 WP_003898845.1.25673 WP_003898845.1.25674 WP_003898845.1.25693 WP_003898845.1.25699 WP_003898845.1.25727 WP_003898845.1.25736 WP_003898845.1.25738 WP_003898845.1.25756 WP_003898845.1.25759 WP_003898845.1.2580 WP_003898845.1.25813 WP_003898845.1.25854 WP_003898845.1.25874 WP_003898845.1.25885 WP_003898845.1.25892 WP_003898845.1.25906 WP_003898845.1.25914 WP_003898845.1.25916 WP_003898845.1.2594 WP_003898845.1.25954 WP_003898845.1.25972 WP_003898845.1.26017 WP_003898845.1.26032 WP_003898845.1.26038 WP_003898845.1.26072 WP_003898845.1.26089 WP_003898845.1.26097 WP_003898845.1.26098 WP_003898845.1.26108 WP_003898845.1.26109 WP_003898845.1.26118 WP_003898845.1.26126 WP_003898845.1.2614 WP_003898845.1.26168 WP_003898845.1.26182 WP_003898845.1.26190 WP_003898845.1.2620 WP_003898845.1.26243 WP_003898845.1.26267 WP_003898845.1.26292 WP_003898845.1.26310 WP_003898845.1.26328 WP_003898845.1.26349 WP_003898845.1.26366 WP_003898845.1.26374 WP_003898845.1.26407 WP_003898845.1.26454 WP_003898845.1.26464 WP_003898845.1.2653 WP_003898845.1.26560 WP_003898845.1.26571 WP_003898845.1.2659 WP_003898845.1.26597 WP_003898845.1.26603 WP_003898845.1.26629 WP_003898845.1.26651 WP_003898845.1.26702 WP_003898845.1.26707 WP_003898845.1.26710 WP_003898845.1.26719 WP_003898845.1.26737 WP_003898845.1.26738 WP_003898845.1.26745 WP_003898845.1.26756 WP_003898845.1.2676 WP_003898845.1.2677 WP_003898845.1.26779 WP_003898845.1.26780 WP_003898845.1.26854 WP_003898845.1.26868 WP_003898845.1.26888 WP_003898845.1.26914 WP_003898845.1.26945 WP_003898845.1.26959 WP_003898845.1.26969 WP_003898845.1.26984 WP_003898845.1.26992 WP_003898845.1.27017 WP_003898845.1.27045 WP_003898845.1.27074 WP_003898845.1.27075 WP_003898845.1.27128 WP_003898845.1.27130 WP_003898845.1.27139 WP_003898845.1.27152 WP_003898845.1.27162 WP_003898845.1.27164 WP_003898845.1.27193 WP_003898845.1.27235 WP_003898845.1.27278 WP_003898845.1.27343 WP_003898845.1.27352 WP_003898845.1.27369 WP_003898845.1.27391 WP_003898845.1.27398 WP_003898845.1.27402 WP_003898845.1.27410 WP_003898845.1.27411 WP_003898845.1.27449 WP_003898845.1.27460 WP_003898845.1.27463 WP_003898845.1.2749 WP_003898845.1.27492 WP_003898845.1.27528 WP_003898845.1.27541 WP_003898845.1.27576 WP_003898845.1.27582 WP_003898845.1.27596 WP_003898845.1.27607 WP_003898845.1.2766 WP_003898845.1.277 WP_003898845.1.27724 WP_003898845.1.27730 WP_003898845.1.27736 WP_003898845.1.27743 WP_003898845.1.27750 WP_003898845.1.27771 WP_003898845.1.27779 WP_003898845.1.27795 WP_003898845.1.27819 WP_003898845.1.27835 WP_003898845.1.27915 WP_003898845.1.27935 WP_003898845.1.27962 WP_003898845.1.28053 WP_003898845.1.28092 WP_003898845.1.28106 WP_003898845.1.28131 WP_003898845.1.28142 WP_003898845.1.28159 WP_003898845.1.2816 WP_003898845.1.28161 WP_003898845.1.28192 WP_003898845.1.28202 WP_003898845.1.28241 WP_003898845.1.28242 WP_003898845.1.28251 WP_003898845.1.28255 WP_003898845.1.28269 WP_003898845.1.28276 WP_003898845.1.28293 WP_003898845.1.28331 WP_003898845.1.28367 WP_003898845.1.28378 WP_003898845.1.28391 WP_003898845.1.2842 WP_003898845.1.28448 WP_003898845.1.2847 WP_003898845.1.28471 WP_003898845.1.28473 WP_003898845.1.28493 WP_003898845.1.28497 WP_003898845.1.28530 WP_003898845.1.28545 WP_003898845.1.28561 WP_003898845.1.28567 WP_003898845.1.28585 WP_003898845.1.286 WP_003898845.1.28610 WP_003898845.1.28617 WP_003898845.1.28634 WP_003898845.1.28642 WP_003898845.1.28671 WP_003898845.1.28682 WP_003898845.1.28698 WP_003898845.1.28703 WP_003898845.1.28739 WP_003898845.1.28781 WP_003898845.1.28787 WP_003898845.1.28827 WP_003898845.1.28839 WP_003898845.1.28847 WP_003898845.1.28850 WP_003898845.1.28851 WP_003898845.1.28865 WP_003898845.1.28897 WP_003898845.1.28914 WP_003898845.1.28935 WP_003898845.1.28936 WP_003898845.1.28939 WP_003898845.1.28943 WP_003898845.1.28952 WP_003898845.1.28975 WP_003898845.1.2899 WP_003898845.1.28993 WP_003898845.1.29000 WP_003898845.1.2901 WP_003898845.1.29028 WP_003898845.1.29033 WP_003898845.1.29058 WP_003898845.1.29115 WP_003898845.1.2916 WP_003898845.1.29217 WP_003898845.1.29223 WP_003898845.1.29234 WP_003898845.1.29264 WP_003898845.1.29275 WP_003898845.1.29306 WP_003898845.1.29339 WP_003898845.1.29348 WP_003898845.1.29364 WP_003898845.1.29367 WP_003898845.1.2938 WP_003898845.1.29399 WP_003898845.1.29426 WP_003898845.1.2944 WP_003898845.1.29449 WP_003898845.1.29450 WP_003898845.1.29452 WP_003898845.1.2949 WP_003898845.1.29510 WP_003898845.1.29515 WP_003898845.1.29525 WP_003898845.1.2953 WP_003898845.1.29587 WP_003898845.1.2959 WP_003898845.1.29592 WP_003898845.1.29599 WP_003898845.1.29611 WP_003898845.1.29632 WP_003898845.1.29649 WP_003898845.1.2965 WP_003898845.1.29659 WP_003898845.1.2969 WP_003898845.1.29696 WP_003898845.1.29698 WP_003898845.1.29718 WP_003898845.1.29745 WP_003898845.1.29747 WP_003898845.1.29769 WP_003898845.1.29825 WP_003898845.1.29830 WP_003898845.1.29847 WP_003898845.1.29861 WP_003898845.1.29869 WP_003898845.1.29883 WP_003898845.1.29890 WP_003898845.1.299 WP_003898845.1.29931 WP_003898845.1.29960 WP_003898845.1.30014 WP_003898845.1.3004 WP_003898845.1.30040 WP_003898845.1.30043 WP_003898845.1.30074 WP_003898845.1.30097 WP_003898845.1.30106 WP_003898845.1.30114 WP_003898845.1.30126 WP_003898845.1.30131 WP_003898845.1.30138 WP_003898845.1.30139 WP_003898845.1.30145 WP_003898845.1.30235 WP_003898845.1.30237 WP_003898845.1.3027 WP_003898845.1.30279 WP_003898845.1.30282 WP_003898845.1.30283 WP_003898845.1.30288 WP_003898845.1.30291 WP_003898845.1.30363 WP_003898845.1.30374 WP_003898845.1.30404 WP_003898845.1.30433 WP_003898845.1.30438 WP_003898845.1.30462 WP_003898845.1.30464 WP_003898845.1.30468 WP_003898845.1.30500 WP_003898845.1.3057 WP_003898845.1.30574 WP_003898845.1.30628 WP_003898845.1.30641 WP_003898845.1.30642 WP_003898845.1.30661 WP_003898845.1.30683 WP_003898845.1.30699 WP_003898845.1.30709 WP_003898845.1.30713 WP_003898845.1.30716 WP_003898845.1.30719 WP_003898845.1.30730 WP_003898845.1.30736 WP_003898845.1.30760 WP_003898845.1.30791 WP_003898845.1.308 WP_003898845.1.30807 WP_003898845.1.30818 WP_003898845.1.30824 WP_003898845.1.30848 WP_003898845.1.30877 WP_003898845.1.30888 WP_003898845.1.30901 WP_003898845.1.30903 WP_003898845.1.30912 WP_003898845.1.30913 WP_003898845.1.30914 WP_003898845.1.30919 WP_003898845.1.30977 WP_003898845.1.3100 WP_003898845.1.31002 WP_003898845.1.3101 WP_003898845.1.31034 WP_003898845.1.31047 WP_003898845.1.31070 WP_003898845.1.31074 WP_003898845.1.31102 WP_003898845.1.31127 WP_003898845.1.31184 WP_003898845.1.31199 WP_003898845.1.31226 WP_003898845.1.31230 WP_003898845.1.31233 WP_003898845.1.31263 WP_003898845.1.31264 WP_003898845.1.31270 WP_003898845.1.31287 WP_003898845.1.31290 WP_003898845.1.31304 WP_003898845.1.31346 WP_003898845.1.31348 WP_003898845.1.31354 WP_003898845.1.31390 WP_003898845.1.31414 WP_003898845.1.31417 WP_003898845.1.31428 WP_003898845.1.3143 WP_003898845.1.31458 WP_003898845.1.31483 WP_003898845.1.3149 WP_003898845.1.31498 WP_003898845.1.31507 WP_003898845.1.31537 WP_003898845.1.31548 WP_003898845.1.31569 WP_003898845.1.31573 WP_003898845.1.316 WP_003898845.1.31629 WP_003898845.1.31666 WP_003898845.1.31693 WP_003898845.1.31703 WP_003898845.1.31744 WP_003898845.1.31745 WP_003898845.1.31770 WP_003898845.1.31776 WP_003898845.1.31783 WP_003898845.1.318 WP_003898845.1.3184 WP_003898845.1.31840 WP_003898845.1.31880 WP_003898845.1.31911 WP_003898845.1.31930 WP_003898845.1.31932 WP_003898845.1.31955 WP_003898845.1.31985 WP_003898845.1.31991 WP_003898845.1.31995 WP_003898845.1.32004 WP_003898845.1.32039 WP_003898845.1.3204 WP_003898845.1.32045 WP_003898845.1.32071 WP_003898845.1.32098 WP_003898845.1.32132 WP_003898845.1.32157 WP_003898845.1.32164 WP_003898845.1.32179 WP_003898845.1.32198 WP_003898845.1.32297 WP_003898845.1.32317 WP_003898845.1.32383 WP_003898845.1.32400 WP_003898845.1.32403 WP_003898845.1.32416 WP_003898845.1.32421 WP_003898845.1.32433 WP_003898845.1.32461 WP_003898845.1.32482 WP_003898845.1.32503 WP_003898845.1.32556 WP_003898845.1.32562 WP_003898845.1.32569 WP_003898845.1.32592 WP_003898845.1.32620 WP_003898845.1.32647 WP_003898845.1.32653 WP_003898845.1.32654 WP_003898845.1.3268 WP_003898845.1.32695 WP_003898845.1.32706 WP_003898845.1.32716 WP_003898845.1.32738 WP_003898845.1.32752 WP_003898845.1.32780 WP_003898845.1.32781 WP_003898845.1.32793 WP_003898845.1.32799 WP_003898845.1.32833 WP_003898845.1.32862 WP_003898845.1.32880 WP_003898845.1.32897 WP_003898845.1.32909 WP_003898845.1.32935 WP_003898845.1.32974 WP_003898845.1.33007 WP_003898845.1.3302 WP_003898845.1.33028 WP_003898845.1.33044 WP_003898845.1.33054 WP_003898845.1.33082 WP_003898845.1.33141 WP_003898845.1.33148 WP_003898845.1.33155 WP_003898845.1.3321 WP_003898845.1.33215 WP_003898845.1.3325 WP_003898845.1.3327 WP_003898845.1.33278 WP_003898845.1.33288 WP_003898845.1.33305 WP_003898845.1.3331 WP_003898845.1.33319 WP_003898845.1.3333 WP_003898845.1.33393 WP_003898845.1.33403 WP_003898845.1.33452 WP_003898845.1.33467 WP_003898845.1.33477 WP_003898845.1.3349 WP_003898845.1.33519 WP_003898845.1.33542 WP_003898845.1.33601 WP_003898845.1.33602 WP_003898845.1.33633 WP_003898845.1.33646 WP_003898845.1.33673 WP_003898845.1.3369 WP_003898845.1.33705 WP_003898845.1.33762 WP_003898845.1.33783 WP_003898845.1.33789 WP_003898845.1.33832 WP_003898845.1.33839 WP_003898845.1.33848 WP_003898845.1.3387 WP_003898845.1.33886 WP_003898845.1.33895 WP_003898845.1.33912 WP_003898845.1.33954 WP_003898845.1.34042 WP_003898845.1.3405 WP_003898845.1.34055 WP_003898845.1.34056 WP_003898845.1.34065 WP_003898845.1.3408 WP_003898845.1.34090 WP_003898845.1.34109 WP_003898845.1.34152 WP_003898845.1.34163 WP_003898845.1.34181 WP_003898845.1.34197 WP_003898845.1.34198 WP_003898845.1.34215 WP_003898845.1.34219 WP_003898845.1.34255 WP_003898845.1.34260 WP_003898845.1.34275 WP_003898845.1.343 WP_003898845.1.34347 WP_003898845.1.34392 WP_003898845.1.344 WP_003898845.1.34428 WP_003898845.1.3443 WP_003898845.1.34435 WP_003898845.1.34446 WP_003898845.1.34499 WP_003898845.1.34505 WP_003898845.1.34516 WP_003898845.1.34529 WP_003898845.1.34551 WP_003898845.1.34563 WP_003898845.1.34576 WP_003898845.1.34581 WP_003898845.1.34588 WP_003898845.1.34596 WP_003898845.1.34599 WP_003898845.1.34639 WP_003898845.1.34673 WP_003898845.1.34724 WP_003898845.1.34740 WP_003898845.1.34755 WP_003898845.1.34777 WP_003898845.1.34783 WP_003898845.1.34841 WP_003898845.1.34908 WP_003898845.1.34919 WP_003898845.1.3492 WP_003898845.1.34933 WP_003898845.1.34945 WP_003898845.1.34946 WP_003898845.1.34954 WP_003898845.1.34960 WP_003898845.1.34961 WP_003898845.1.34963 WP_003898845.1.34965 WP_003898845.1.34968 WP_003898845.1.35023 WP_003898845.1.35069 WP_003898845.1.35072 WP_003898845.1.35078 WP_003898845.1.35156 WP_003898845.1.35160 WP_003898845.1.35162 WP_003898845.1.35176 WP_003898845.1.3520 WP_003898845.1.35213 WP_003898845.1.35221 WP_003898845.1.35246 WP_003898845.1.35278 WP_003898845.1.35301 WP_003898845.1.35311 WP_003898845.1.35312 WP_003898845.1.35317 WP_003898845.1.35319 WP_003898845.1.35347 WP_003898845.1.35363 WP_003898845.1.35382 WP_003898845.1.35385 WP_003898845.1.35396 WP_003898845.1.35397 WP_003898845.1.35426 WP_003898845.1.35439 WP_003898845.1.35455 WP_003898845.1.3548 WP_003898845.1.35484 WP_003898845.1.35492 WP_003898845.1.3553 WP_003898845.1.35553 WP_003898845.1.35555 WP_003898845.1.35561 WP_003898845.1.35602 WP_003898845.1.35610 WP_003898845.1.35635 WP_003898845.1.35657 WP_003898845.1.35687 WP_003898845.1.35689 WP_003898845.1.35707 WP_003898845.1.35732 WP_003898845.1.35754 WP_003898845.1.35767 WP_003898845.1.35770 WP_003898845.1.35771 WP_003898845.1.35780 WP_003898845.1.35805 WP_003898845.1.35811 WP_003898845.1.35821 WP_003898845.1.3584 WP_003898845.1.35848 WP_003898845.1.35864 WP_003898845.1.35874 WP_003898845.1.35876 WP_003898845.1.35899 WP_003898845.1.35954 WP_003898845.1.36005 WP_003898845.1.36014 WP_003898845.1.36023 WP_003898845.1.36051 WP_003898845.1.36053 WP_003898845.1.36075 WP_003898845.1.36089 WP_003898845.1.36097 WP_003898845.1.36098 WP_003898845.1.36116 WP_003898845.1.36145 WP_003898845.1.36205 WP_003898845.1.36228 WP_003898845.1.36252 WP_003898845.1.36260 WP_003898845.1.36271 WP_003898845.1.36303 WP_003898845.1.36309 WP_003898845.1.36315 WP_003898845.1.36319 WP_003898845.1.36321 WP_003898845.1.36326 WP_003898845.1.3634 WP_003898845.1.36356 WP_003898845.1.36357 WP_003898845.1.3636 WP_003898845.1.36385 WP_003898845.1.36399 WP_003898845.1.36436 WP_003898845.1.36465 WP_003898845.1.36469 WP_003898845.1.36473 WP_003898845.1.36485 WP_003898845.1.36508 WP_003898845.1.36540 WP_003898845.1.36561 WP_003898845.1.36571 WP_003898845.1.36573 WP_003898845.1.36578 WP_003898845.1.36585 WP_003898845.1.36597 WP_003898845.1.36614 WP_003898845.1.36674 WP_003898845.1.36720 WP_003898845.1.36727 WP_003898845.1.36733 WP_003898845.1.36785 WP_003898845.1.36810 WP_003898845.1.36862 WP_003898845.1.36893 WP_003898845.1.36901 WP_003898845.1.36921 WP_003898845.1.36935 WP_003898845.1.36941 WP_003898845.1.3695 WP_003898845.1.36968 WP_003898845.1.3700 WP_003898845.1.37004 WP_003898845.1.37012 WP_003898845.1.37071 WP_003898845.1.37088 WP_003898845.1.37131 WP_003898845.1.37157 WP_003898845.1.37175 WP_003898845.1.37188 WP_003898845.1.37213 WP_003898845.1.37229 WP_003898845.1.3724 WP_003898845.1.37277 WP_003898845.1.37305 WP_003898845.1.37330 WP_003898845.1.37389 WP_003898845.1.37400 WP_003898845.1.37440 WP_003898845.1.37459 WP_003898845.1.37468 WP_003898845.1.37475 WP_003898845.1.37484 WP_003898845.1.37601 WP_003898845.1.37612 WP_003898845.1.37632 WP_003898845.1.37643 WP_003898845.1.37655 WP_003898845.1.37660 WP_003898845.1.37674 WP_003898845.1.37700 WP_003898845.1.37701 WP_003898845.1.37709 WP_003898845.1.37711 WP_003898845.1.37721 WP_003898845.1.37722 WP_003898845.1.37747 WP_003898845.1.37765 WP_003898845.1.37772 WP_003898845.1.37804 WP_003898845.1.37809 WP_003898845.1.37859 WP_003898845.1.37877 WP_003898845.1.37912 WP_003898845.1.37913 WP_003898845.1.37943 WP_003898845.1.37950 WP_003898845.1.37973 WP_003898845.1.37975 WP_003898845.1.37983 WP_003898845.1.38 WP_003898845.1.38002 WP_003898845.1.3802 WP_003898845.1.38039 WP_003898845.1.38040 WP_003898845.1.38067 WP_003898845.1.38138 WP_003898845.1.38144 WP_003898845.1.38158 WP_003898845.1.38159 WP_003898845.1.38210 WP_003898845.1.38233 WP_003898845.1.38240 WP_003898845.1.38299 WP_003898845.1.38332 WP_003898845.1.38347 WP_003898845.1.38354 WP_003898845.1.38389 WP_003898845.1.38398 WP_003898845.1.38402 WP_003898845.1.38418 WP_003898845.1.38421 WP_003898845.1.38466 WP_003898845.1.38477 WP_003898845.1.38483 WP_003898845.1.3849 WP_003898845.1.385 WP_003898845.1.38530 WP_003898845.1.38535 WP_003898845.1.38594 WP_003898845.1.38611 WP_003898845.1.38638 WP_003898845.1.38639 WP_003898845.1.38646 WP_003898845.1.38648 WP_003898845.1.38654 WP_003898845.1.38660 WP_003898845.1.38666 WP_003898845.1.38671 WP_003898845.1.38672 WP_003898845.1.38677 WP_003898845.1.38750 WP_003898845.1.38772 WP_003898845.1.38812 WP_003898845.1.38821 WP_003898845.1.38844 WP_003898845.1.38863 WP_003898845.1.38873 WP_003898845.1.3889 WP_003898845.1.38894 WP_003898845.1.38909 WP_003898845.1.38939 WP_003898845.1.38974 WP_003898845.1.38975 WP_003898845.1.38991 WP_003898845.1.39025 WP_003898845.1.39070 WP_003898845.1.39072 WP_003898845.1.39095 WP_003898845.1.39106 WP_003898845.1.39165 WP_003898845.1.39174 WP_003898845.1.39176 WP_003898845.1.39178 WP_003898845.1.39190 WP_003898845.1.39201 WP_003898845.1.39207 WP_003898845.1.39236 WP_003898845.1.39239 WP_003898845.1.39252 WP_003898845.1.39288 WP_003898845.1.39295 WP_003898845.1.39306 WP_003898845.1.39359 WP_003898845.1.39364 WP_003898845.1.39400 WP_003898845.1.39447 WP_003898845.1.3945 WP_003898845.1.39450 WP_003898845.1.39455 WP_003898845.1.39521 WP_003898845.1.39560 WP_003898845.1.39592 WP_003898845.1.39593 WP_003898845.1.396 WP_003898845.1.3960 WP_003898845.1.39616 WP_003898845.1.39654 WP_003898845.1.39657 WP_003898845.1.39661 WP_003898845.1.39674 WP_003898845.1.39678 WP_003898845.1.3968 WP_003898845.1.39694 WP_003898845.1.3971 WP_003898845.1.39718 WP_003898845.1.39728 WP_003898845.1.39739 WP_003898845.1.39748 WP_003898845.1.39751 WP_003898845.1.39759 WP_003898845.1.39801 WP_003898845.1.39804 WP_003898845.1.39848 WP_003898845.1.39877 WP_003898845.1.39925 WP_003898845.1.3994 WP_003898845.1.39959 WP_003898845.1.3996 WP_003898845.1.39960 WP_003898845.1.3997 WP_003898845.1.39980 WP_003898845.1.40000 WP_003898845.1.40028 WP_003898845.1.4003 WP_003898845.1.40094 WP_003898845.1.40096 WP_003898845.1.40150 WP_003898845.1.40156 WP_003898845.1.40174 WP_003898845.1.40186 WP_003898845.1.40276 WP_003898845.1.40277 WP_003898845.1.40323 WP_003898845.1.40336 WP_003898845.1.40353 WP_003898845.1.4036 WP_003898845.1.40372 WP_003898845.1.40402 WP_003898845.1.40413 WP_003898845.1.40440 WP_003898845.1.40446 WP_003898845.1.40451 WP_003898845.1.40455 WP_003898845.1.40523 WP_003898845.1.40641 WP_003898845.1.40646 WP_003898845.1.40651 WP_003898845.1.40653 WP_003898845.1.4067 WP_003898845.1.40705 WP_003898845.1.40723 WP_003898845.1.40731 WP_003898845.1.40735 WP_003898845.1.40795 WP_003898845.1.40799 WP_003898845.1.40876 WP_003898845.1.40881 WP_003898845.1.40922 WP_003898845.1.4095 WP_003898845.1.40956 WP_003898845.1.40957 WP_003898845.1.40964 WP_003898845.1.4097 WP_003898845.1.410 WP_003898845.1.41000 WP_003898845.1.41055 WP_003898845.1.41108 WP_003898845.1.41123 WP_003898845.1.41177 WP_003898845.1.41202 WP_003898845.1.41219 WP_003898845.1.41231 WP_003898845.1.41249 WP_003898845.1.4127 WP_003898845.1.41355 WP_003898845.1.41376 WP_003898845.1.41430 WP_003898845.1.41447 WP_003898845.1.41469 WP_003898845.1.41504 WP_003898845.1.41553 WP_003898845.1.41564 WP_003898845.1.41632 WP_003898845.1.41635 WP_003898845.1.41636 WP_003898845.1.41648 WP_003898845.1.41660 WP_003898845.1.41685 WP_003898845.1.41695 WP_003898845.1.41704 WP_003898845.1.4171 WP_003898845.1.41719 WP_003898845.1.41733 WP_003898845.1.41744 WP_003898845.1.41774 WP_003898845.1.41791 WP_003898845.1.41803 WP_003898845.1.41820 WP_003898845.1.41828 WP_003898845.1.41829 WP_003898845.1.41860 WP_003898845.1.41912 WP_003898845.1.41921 WP_003898845.1.41933 WP_003898845.1.41944 WP_003898845.1.42043 WP_003898845.1.42075 WP_003898845.1.42078 WP_003898845.1.42094 WP_003898845.1.42112 WP_003898845.1.4212 WP_003898845.1.42122 WP_003898845.1.42134 WP_003898845.1.42183 WP_003898845.1.42188 WP_003898845.1.42202 WP_003898845.1.42208 WP_003898845.1.42247 WP_003898845.1.42255 WP_003898845.1.42273 WP_003898845.1.42278 WP_003898845.1.42304 WP_003898845.1.42309 WP_003898845.1.42370 WP_003898845.1.42385 WP_003898845.1.42400 WP_003898845.1.42409 WP_003898845.1.42414 WP_003898845.1.42430 WP_003898845.1.42461 WP_003898845.1.42465 WP_003898845.1.42467 WP_003898845.1.42473 WP_003898845.1.42474 WP_003898845.1.4248 WP_003898845.1.42494 WP_003898845.1.42519 WP_003898845.1.42524 WP_003898845.1.42534 WP_003898845.1.42562 WP_003898845.1.42568 WP_003898845.1.42570 WP_003898845.1.42618 WP_003898845.1.42660 WP_003898845.1.42695 WP_003898845.1.42704 WP_003898845.1.42705 WP_003898845.1.42722 WP_003898845.1.42777 WP_003898845.1.42782 WP_003898845.1.42835 WP_003898845.1.42839 WP_003898845.1.42842 WP_003898845.1.42905 WP_003898845.1.42916 WP_003898845.1.42930 WP_003898845.1.42971 WP_003898845.1.43005 WP_003898845.1.43009 WP_003898845.1.43053 WP_003898845.1.43082 WP_003898845.1.43087 WP_003898845.1.43098 WP_003898845.1.43208 WP_003898845.1.43236 WP_003898845.1.43246 WP_003898845.1.43255 WP_003898845.1.43266 WP_003898845.1.43269 WP_003898845.1.43273 WP_003898845.1.43296 WP_003898845.1.43306 WP_003898845.1.4335 WP_003898845.1.43368 WP_003898845.1.43395 WP_003898845.1.43457 WP_003898845.1.43462 WP_003898845.1.43475 WP_003898845.1.43478 WP_003898845.1.43484 WP_003898845.1.43557 WP_003898845.1.43578 WP_003898845.1.43588 WP_003898845.1.43643 WP_003898845.1.43664 WP_003898845.1.43684 WP_003898845.1.43686 WP_003898845.1.43706 WP_003898845.1.43716 WP_003898845.1.4377 WP_003898845.1.43781 WP_003898845.1.43794 WP_003898845.1.43815 WP_003898845.1.43846 WP_003898845.1.43861 WP_003898845.1.43863 WP_003898845.1.43866 WP_003898845.1.43872 WP_003898845.1.43885 WP_003898845.1.43897 WP_003898845.1.4390 WP_003898845.1.43902 WP_003898845.1.43921 WP_003898845.1.43936 WP_003898845.1.43937 WP_003898845.1.43960 WP_003898845.1.43965 WP_003898845.1.4399 WP_003898845.1.43993 WP_003898845.1.43996 WP_003898845.1.44 WP_003898845.1.44001 WP_003898845.1.44008 WP_003898845.1.44033 WP_003898845.1.44037 WP_003898845.1.44070 WP_003898845.1.44071 WP_003898845.1.44076 WP_003898845.1.44104 WP_003898845.1.44111 WP_003898845.1.44124 WP_003898845.1.44169 WP_003898845.1.44219 WP_003898845.1.44237 WP_003898845.1.44277 WP_003898845.1.44279 WP_003898845.1.44336 WP_003898845.1.44355 WP_003898845.1.44358 WP_003898845.1.4438 WP_003898845.1.44390 WP_003898845.1.44392 WP_003898845.1.4441 WP_003898845.1.44415 WP_003898845.1.44466 WP_003898845.1.44489 WP_003898845.1.44492 WP_003898845.1.44494 WP_003898845.1.44500 WP_003898845.1.44519 WP_003898845.1.44532 WP_003898845.1.44534 WP_003898845.1.44562 WP_003898845.1.44597 WP_003898845.1.44600 WP_003898845.1.44602 WP_003898845.1.44615 WP_003898845.1.4464 WP_003898845.1.44651 WP_003898845.1.44659 WP_003898845.1.44665 WP_003898845.1.44694 WP_003898845.1.44700 WP_003898845.1.44713 WP_003898845.1.44735 WP_003898845.1.44740 WP_003898845.1.44757 WP_003898845.1.4476 WP_003898845.1.44761 WP_003898845.1.44767 WP_003898845.1.44776 WP_003898845.1.44779 WP_003898845.1.44786 WP_003898845.1.44808 WP_003898845.1.44864 WP_003898845.1.44901 WP_003898845.1.44908 WP_003898845.1.44913 WP_003898845.1.4492 WP_003898845.1.44939 WP_003898845.1.44979 WP_003898845.1.44981 WP_003898845.1.45002 WP_003898845.1.45011 WP_003898845.1.4504 WP_003898845.1.45062 WP_003898845.1.45081 WP_003898845.1.45113 WP_003898845.1.45129 WP_003898845.1.45135 WP_003898845.1.45147 WP_003898845.1.45168 WP_003898845.1.4517 WP_003898845.1.45181 WP_003898845.1.45185 WP_003898845.1.45192 WP_003898845.1.45200 WP_003898845.1.45205 WP_003898845.1.45211 WP_003898845.1.45249 WP_003898845.1.4526 WP_003898845.1.45286 WP_003898845.1.45326 WP_003898845.1.45347 WP_003898845.1.45374 WP_003898845.1.45390 WP_003898845.1.454 WP_003898845.1.45407 WP_003898845.1.45451 WP_003898845.1.45453 WP_003898845.1.45460 WP_003898845.1.45463 WP_003898845.1.45470 WP_003898845.1.45474 WP_003898845.1.45491 WP_003898845.1.45510 WP_003898845.1.45563 WP_003898845.1.45584 WP_003898845.1.45590 WP_003898845.1.45619 WP_003898845.1.45626 WP_003898845.1.45631 WP_003898845.1.45666 WP_003898845.1.45697 WP_003898845.1.4571 WP_003898845.1.45731 WP_003898845.1.45743 WP_003898845.1.45765 WP_003898845.1.45776 WP_003898845.1.45805 WP_003898845.1.45815 WP_003898845.1.45849 WP_003898845.1.45867 WP_003898845.1.4590 WP_003898845.1.45923 WP_003898845.1.45926 WP_003898845.1.45963 WP_003898845.1.45992 WP_003898845.1.46025 WP_003898845.1.46083 WP_003898845.1.46090 WP_003898845.1.46092 WP_003898845.1.46100 WP_003898845.1.46101 WP_003898845.1.46103 WP_003898845.1.46107 WP_003898845.1.46127 WP_003898845.1.46128 WP_003898845.1.46129 WP_003898845.1.46141 WP_003898845.1.46150 WP_003898845.1.46201 WP_003898845.1.46226 WP_003898845.1.4624 WP_003898845.1.46253 WP_003898845.1.46268 WP_003898845.1.46285 WP_003898845.1.46300 WP_003898845.1.46313 WP_003898845.1.46336 WP_003898845.1.46365 WP_003898845.1.46370 WP_003898845.1.46381 WP_003898845.1.46411 WP_003898845.1.4644 WP_003898845.1.46442 WP_003898845.1.46453 WP_003898845.1.46478 WP_003898845.1.46492 WP_003898845.1.46521 WP_003898845.1.4653 WP_003898845.1.46532 WP_003898845.1.46539 WP_003898845.1.46568 WP_003898845.1.46585 WP_003898845.1.46609 WP_003898845.1.46613 WP_003898845.1.46625 WP_003898845.1.46642 WP_003898845.1.46647 WP_003898845.1.46724 WP_003898845.1.46758 WP_003898845.1.46777 WP_003898845.1.46786 WP_003898845.1.46792 WP_003898845.1.46847 WP_003898845.1.46851 WP_003898845.1.4687 WP_003898845.1.46897 WP_003898845.1.46936 WP_003898845.1.46980 WP_003898845.1.47011 WP_003898845.1.47066 WP_003898845.1.47077 WP_003898845.1.47083 WP_003898845.1.47106 WP_003898845.1.47142 WP_003898845.1.47147 WP_003898845.1.47166 WP_003898845.1.47178 WP_003898845.1.47179 WP_003898845.1.47194 WP_003898845.1.47207 WP_003898845.1.47210 WP_003898845.1.47261 WP_003898845.1.47262 WP_003898845.1.47402 WP_003898845.1.47423 WP_003898845.1.47467 WP_003898845.1.47502 WP_003898845.1.4751 WP_003898845.1.47511 WP_003898845.1.47537 WP_003898845.1.47540 WP_003898845.1.47568 WP_003898845.1.47572 WP_003898845.1.47588 WP_003898845.1.47636 WP_003898845.1.4764 WP_003898845.1.47653 WP_003898845.1.47679 WP_003898845.1.47681 WP_003898845.1.47690 WP_003898845.1.4771 WP_003898845.1.47717 WP_003898845.1.47743 WP_003898845.1.47754 WP_003898845.1.47773 WP_003898845.1.47776 WP_003898845.1.47780 WP_003898845.1.47805 WP_003898845.1.47832 WP_003898845.1.47847 WP_003898845.1.47858 WP_003898845.1.47861 WP_003898845.1.47868 WP_003898845.1.47893 WP_003898845.1.47899 WP_003898845.1.479 WP_003898845.1.47912 WP_003898845.1.47913 WP_003898845.1.47926 WP_003898845.1.4794 WP_003898845.1.47943 WP_003898845.1.47944 WP_003898845.1.47959 WP_003898845.1.47974 WP_003898845.1.47993 WP_003898845.1.48004 WP_003898845.1.48039 WP_003898845.1.48050 WP_003898845.1.48084 WP_003898845.1.48097 WP_003898845.1.48101 WP_003898845.1.4813 WP_003898845.1.48130 WP_003898845.1.48135 WP_003898845.1.48143 WP_003898845.1.48152 WP_003898845.1.48155 WP_003898845.1.48170 WP_003898845.1.48173 WP_003898845.1.48177 WP_003898845.1.48185 WP_003898845.1.48204 WP_003898845.1.48219 WP_003898845.1.4823 WP_003898845.1.48240 WP_003898845.1.48256 WP_003898845.1.48264 WP_003898845.1.48287 WP_003898845.1.48330 WP_003898845.1.48333 WP_003898845.1.48348 WP_003898845.1.48354 WP_003898845.1.48372 WP_003898845.1.48383 WP_003898845.1.48388 WP_003898845.1.48419 WP_003898845.1.48423 WP_003898845.1.48443 WP_003898845.1.48543 WP_003898845.1.48550 WP_003898845.1.48605 WP_003898845.1.48618 WP_003898845.1.4863 WP_003898845.1.48658 WP_003898845.1.48666 WP_003898845.1.48687 WP_003898845.1.48779 WP_003898845.1.4878 WP_003898845.1.48798 WP_003898845.1.48802 WP_003898845.1.48826 WP_003898845.1.48831 WP_003898845.1.48843 WP_003898845.1.48857 WP_003898845.1.4890 WP_003898845.1.48946 WP_003898845.1.48979 WP_003898845.1.49017 WP_003898845.1.49048 WP_003898845.1.49059 WP_003898845.1.4906 WP_003898845.1.4907 WP_003898845.1.49103 WP_003898845.1.49110 WP_003898845.1.49111 WP_003898845.1.49112 WP_003898845.1.4919 WP_003898845.1.49251 WP_003898845.1.49254 WP_003898845.1.49263 WP_003898845.1.49291 WP_003898845.1.49296 WP_003898845.1.49335 WP_003898845.1.49337 WP_003898845.1.49419 WP_003898845.1.49426 WP_003898845.1.49437 WP_003898845.1.49439 WP_003898845.1.49474 WP_003898845.1.49506 WP_003898845.1.49523 WP_003898845.1.49526 WP_003898845.1.49532 WP_003898845.1.4959 WP_003898845.1.49678 WP_003898845.1.49687 WP_003898845.1.49699 WP_003898845.1.49709 WP_003898845.1.4971 WP_003898845.1.4972 WP_003898845.1.49736 WP_003898845.1.49746 WP_003898845.1.49764 WP_003898845.1.49773 WP_003898845.1.49796 WP_003898845.1.49814 WP_003898845.1.49815 WP_003898845.1.49816 WP_003898845.1.49839 WP_003898845.1.49857 WP_003898845.1.49878 WP_003898845.1.49880 WP_003898845.1.49944 WP_003898845.1.4999 WP_003898845.1.49990 WP_003898845.1.50068 WP_003898845.1.50077 WP_003898845.1.5008 WP_003898845.1.50081 WP_003898845.1.50122 WP_003898845.1.50126 WP_003898845.1.50149 WP_003898845.1.50162 WP_003898845.1.5018 WP_003898845.1.50194 WP_003898845.1.50218 WP_003898845.1.50235 WP_003898845.1.50249 WP_003898845.1.50265 WP_003898845.1.50271 WP_003898845.1.50324 WP_003898845.1.50347 WP_003898845.1.50372 WP_003898845.1.50398 WP_003898845.1.50407 WP_003898845.1.50444 WP_003898845.1.50466 WP_003898845.1.50472 WP_003898845.1.5048 WP_003898845.1.50498 WP_003898845.1.5050 WP_003898845.1.50540 WP_003898845.1.50554 WP_003898845.1.50557 WP_003898845.1.50601 WP_003898845.1.50610 WP_003898845.1.50632 WP_003898845.1.50655 WP_003898845.1.50659 WP_003898845.1.50683 WP_003898845.1.50689 WP_003898845.1.50692 WP_003898845.1.50714 WP_003898845.1.50729 WP_003898845.1.50756 WP_003898845.1.50784 WP_003898845.1.50794 WP_003898845.1.50841 WP_003898845.1.50877 WP_003898845.1.5096 WP_003898845.1.50981 WP_003898845.1.50987 WP_003898845.1.51003 WP_003898845.1.51009 WP_003898845.1.51037 WP_003898845.1.51074 WP_003898845.1.51082 WP_003898845.1.51101 WP_003898845.1.51116 WP_003898845.1.51149 WP_003898845.1.51156 WP_003898845.1.51157 WP_003898845.1.51213 WP_003898845.1.51232 WP_003898845.1.51239 WP_003898845.1.51247 WP_003898845.1.51266 WP_003898845.1.51279 WP_003898845.1.51291 WP_003898845.1.51294 WP_003898845.1.51301 WP_003898845.1.51329 WP_003898845.1.51391 WP_003898845.1.51422 WP_003898845.1.51445 WP_003898845.1.51455 WP_003898845.1.51466 WP_003898845.1.51468 WP_003898845.1.51478 WP_003898845.1.51497 WP_003898845.1.51520 WP_003898845.1.51593 WP_003898845.1.51628 WP_003898845.1.5164 WP_003898845.1.51647 WP_003898845.1.51660 WP_003898845.1.51696 WP_003898845.1.51721 WP_003898845.1.51788 WP_003898845.1.51795 WP_003898845.1.51801 WP_003898845.1.51817 WP_003898845.1.51819 WP_003898845.1.51854 WP_003898845.1.51923 WP_003898845.1.51942 WP_003898845.1.51948 WP_003898845.1.51963 WP_003898845.1.51969 WP_003898845.1.52000 WP_003898845.1.52001 WP_003898845.1.52003 WP_003898845.1.52006 WP_003898845.1.52036 WP_003898845.1.52046 WP_003898845.1.52059 WP_003898845.1.52069 WP_003898845.1.52082 WP_003898845.1.52102 WP_003898845.1.52166 WP_003898845.1.52168 WP_003898845.1.52173 WP_003898845.1.52178 WP_003898845.1.52206 WP_003898845.1.52216 WP_003898845.1.52238 WP_003898845.1.52241 WP_003898845.1.52280 WP_003898845.1.52314 WP_003898845.1.52385 WP_003898845.1.52390 WP_003898845.1.524 WP_003898845.1.52460 WP_003898845.1.52485 WP_003898845.1.52486 WP_003898845.1.52495 WP_003898845.1.52504 WP_003898845.1.52522 WP_003898845.1.52531 WP_003898845.1.52533 WP_003898845.1.52545 WP_003898845.1.52553 WP_003898845.1.52563 WP_003898845.1.52564 WP_003898845.1.52574 WP_003898845.1.52641 WP_003898845.1.52673 WP_003898845.1.52674 WP_003898845.1.52708 WP_003898845.1.52713 WP_003898845.1.52761 WP_003898845.1.52778 WP_003898845.1.52797 WP_003898845.1.52818 WP_003898845.1.52872 WP_003898845.1.52873 WP_003898845.1.52891 WP_003898845.1.52892 WP_003898845.1.52909 WP_003898845.1.52970 WP_003898845.1.52998 WP_003898845.1.53053 WP_003898845.1.53056 WP_003898845.1.5306 WP_003898845.1.53088 WP_003898845.1.5309 WP_003898845.1.531 WP_003898845.1.53117 WP_003898845.1.53118 WP_003898845.1.53142 WP_003898845.1.53143 WP_003898845.1.53157 WP_003898845.1.53167 WP_003898845.1.53200 WP_003898845.1.53213 WP_003898845.1.53217 WP_003898845.1.53226 WP_003898845.1.53229 WP_003898845.1.53230 WP_003898845.1.53237 WP_003898845.1.53254 WP_003898845.1.53257 WP_003898845.1.5327 WP_003898845.1.53276 WP_003898845.1.53278 WP_003898845.1.533 WP_003898845.1.53306 WP_003898845.1.5334 WP_003898845.1.5335 WP_003898845.1.53353 WP_003898845.1.53381 WP_003898845.1.53413 WP_003898845.1.53458 WP_003898845.1.53460 WP_003898845.1.53480 WP_003898845.1.53517 WP_003898845.1.53522 WP_003898845.1.53525 WP_003898845.1.53526 WP_003898845.1.53553 WP_003898845.1.53606 WP_003898845.1.53628 WP_003898845.1.53643 WP_003898845.1.53667 WP_003898845.1.53679 WP_003898845.1.53715 WP_003898845.1.53730 WP_003898845.1.53742 WP_003898845.1.53743 WP_003898845.1.53754 WP_003898845.1.53775 WP_003898845.1.53787 WP_003898845.1.53803 WP_003898845.1.53818 WP_003898845.1.53853 WP_003898845.1.53865 WP_003898845.1.53888 WP_003898845.1.53900 WP_003898845.1.53912 WP_003898845.1.53914 WP_003898845.1.53952 WP_003898845.1.53973 WP_003898845.1.5398 WP_003898845.1.5408 WP_003898845.1.54089 WP_003898845.1.54093 WP_003898845.1.54099 WP_003898845.1.54112 WP_003898845.1.54125 WP_003898845.1.54141 WP_003898845.1.54162 WP_003898845.1.54179 WP_003898845.1.54206 WP_003898845.1.54218 WP_003898845.1.54225 WP_003898845.1.54227 WP_003898845.1.54232 WP_003898845.1.54241 WP_003898845.1.54245 WP_003898845.1.54247 WP_003898845.1.54260 WP_003898845.1.54275 WP_003898845.1.54280 WP_003898845.1.5429 WP_003898845.1.54294 WP_003898845.1.54314 WP_003898845.1.54351 WP_003898845.1.54370 WP_003898845.1.54428 WP_003898845.1.54449 WP_003898845.1.54494 WP_003898845.1.54514 WP_003898845.1.54519 WP_003898845.1.5452 WP_003898845.1.54531 WP_003898845.1.54537 WP_003898845.1.54553 WP_003898845.1.54555 WP_003898845.1.54575 WP_003898845.1.54633 WP_003898845.1.54686 WP_003898845.1.54687 WP_003898845.1.54705 WP_003898845.1.54730 WP_003898845.1.54732 WP_003898845.1.5475 WP_003898845.1.54797 WP_003898845.1.54807 WP_003898845.1.54836 WP_003898845.1.54838 WP_003898845.1.54860 WP_003898845.1.54888 WP_003898845.1.54897 WP_003898845.1.54905 WP_003898845.1.54909 WP_003898845.1.54937 WP_003898845.1.54939 WP_003898845.1.54944 WP_003898845.1.54945 WP_003898845.1.54953 WP_003898845.1.54964 WP_003898845.1.55015 WP_003898845.1.55022 WP_003898845.1.55023 WP_003898845.1.55051 WP_003898845.1.55072 WP_003898845.1.55088 WP_003898845.1.55106 WP_003898845.1.55126 WP_003898845.1.55128 WP_003898845.1.55140 WP_003898845.1.55150 WP_003898845.1.55210 WP_003898845.1.55227 WP_003898845.1.55248 WP_003898845.1.55257 WP_003898845.1.55258 WP_003898845.1.55267 WP_003898845.1.55279 WP_003898845.1.55307 WP_003898845.1.55326 WP_003898845.1.55328 WP_003898845.1.5533 WP_003898845.1.55345 WP_003898845.1.55396 WP_003898845.1.55398 WP_003898845.1.55441 WP_003898845.1.55459 WP_003898845.1.55501 WP_003898845.1.55504 WP_003898845.1.55578 WP_003898845.1.55626 WP_003898845.1.55641 WP_003898845.1.5569 WP_003898845.1.55723 WP_003898845.1.55735 WP_003898845.1.5574 WP_003898845.1.55772 WP_003898845.1.55802 WP_003898845.1.55819 WP_003898845.1.55821 WP_003898845.1.5583 WP_003898845.1.55849 WP_003898845.1.55856 WP_003898845.1.55860 WP_003898845.1.55882 WP_003898845.1.55883 WP_003898845.1.55894 WP_003898845.1.55902 WP_003898845.1.55908 WP_003898845.1.55909 WP_003898845.1.5591 WP_003898845.1.55961 WP_003898845.1.55977 WP_003898845.1.55983 WP_003898845.1.56028 WP_003898845.1.56057 WP_003898845.1.56060 WP_003898845.1.56107 WP_003898845.1.56132 WP_003898845.1.56163 WP_003898845.1.56167 WP_003898845.1.56178 WP_003898845.1.56287 WP_003898845.1.56292 WP_003898845.1.56327 WP_003898845.1.56341 WP_003898845.1.56359 WP_003898845.1.56365 WP_003898845.1.56394 WP_003898845.1.56443 WP_003898845.1.56473 WP_003898845.1.56478 WP_003898845.1.56500 WP_003898845.1.56517 WP_003898845.1.56534 WP_003898845.1.5656 WP_003898845.1.56577 WP_003898845.1.56593 WP_003898845.1.56625 WP_003898845.1.56637 WP_003898845.1.56670 WP_003898845.1.56697 WP_003898845.1.567 WP_003898845.1.56701 WP_003898845.1.56709 WP_003898845.1.56743 WP_003898845.1.56755 WP_003898845.1.56764 WP_003898845.1.56769 WP_003898845.1.56770 WP_003898845.1.56795 WP_003898845.1.5681 WP_003898845.1.56827 WP_003898845.1.56839 WP_003898845.1.56863 WP_003898845.1.56868 WP_003898845.1.56869 WP_003898845.1.56915 WP_003898845.1.56926 WP_003898845.1.56961 WP_003898845.1.56971 WP_003898845.1.56972 WP_003898845.1.57023 WP_003898845.1.57035 WP_003898845.1.57077 WP_003898845.1.57087 WP_003898845.1.57094 WP_003898845.1.57134 WP_003898845.1.57169 WP_003898845.1.57208 WP_003898845.1.57212 WP_003898845.1.57230 WP_003898845.1.5724 WP_003898845.1.5725 WP_003898845.1.5727 WP_003898845.1.57273 WP_003898845.1.573 WP_003898845.1.57314 WP_003898845.1.57326 WP_003898845.1.57328 WP_003898845.1.57331 WP_003898845.1.57340 WP_003898845.1.57351 WP_003898845.1.57352 WP_003898845.1.57380 WP_003898845.1.57430 WP_003898845.1.5744 WP_003898845.1.57440 WP_003898845.1.5745 WP_003898845.1.57461 WP_003898845.1.57469 WP_003898845.1.57489 WP_003898845.1.575 WP_003898845.1.57509 WP_003898845.1.57519 WP_003898845.1.57525 WP_003898845.1.57551 WP_003898845.1.57596 WP_003898845.1.57604 WP_003898845.1.57619 WP_003898845.1.57627 WP_003898845.1.57642 WP_003898845.1.57658 WP_003898845.1.57667 WP_003898845.1.57675 WP_003898845.1.57689 WP_003898845.1.57708 WP_003898845.1.57794 WP_003898845.1.57821 WP_003898845.1.57825 WP_003898845.1.57843 WP_003898845.1.57906 WP_003898845.1.57924 WP_003898845.1.57926 WP_003898845.1.57957 WP_003898845.1.57960 WP_003898845.1.57964 WP_003898845.1.57991 WP_003898845.1.58086 WP_003898845.1.58103 WP_003898845.1.58108 WP_003898845.1.5811 WP_003898845.1.58121 WP_003898845.1.58145 WP_003898845.1.58164 WP_003898845.1.58174 WP_003898845.1.582 WP_003898845.1.58209 WP_003898845.1.58215 WP_003898845.1.5824 WP_003898845.1.58250 WP_003898845.1.58259 WP_003898845.1.58283 WP_003898845.1.58288 WP_003898845.1.5830 WP_003898845.1.58303 WP_003898845.1.58311 WP_003898845.1.58330 WP_003898845.1.58359 WP_003898845.1.58386 WP_003898845.1.58393 WP_003898845.1.58431 WP_003898845.1.5844 WP_003898845.1.58457 WP_003898845.1.58488 WP_003898845.1.58518 WP_003898845.1.58534 WP_003898845.1.58559 WP_003898845.1.58567 WP_003898845.1.58573 WP_003898845.1.58602 WP_003898845.1.58612 WP_003898845.1.58619 WP_003898845.1.58630 WP_003898845.1.5865 WP_003898845.1.58671 WP_003898845.1.58690 WP_003898845.1.58702 WP_003898845.1.58743 WP_003898845.1.58754 WP_003898845.1.5879 WP_003898845.1.5881 WP_003898845.1.58824 WP_003898845.1.58848 WP_003898845.1.58857 WP_003898845.1.58891 WP_003898845.1.58892 WP_003898845.1.5890 WP_003898845.1.58904 WP_003898845.1.58921 WP_003898845.1.58930 WP_003898845.1.58953 WP_003898845.1.58961 WP_003898845.1.5898 WP_003898845.1.59025 WP_003898845.1.59029 WP_003898845.1.59037 WP_003898845.1.59044 WP_003898845.1.59085 WP_003898845.1.59088 WP_003898845.1.59112 WP_003898845.1.59130 WP_003898845.1.5914 WP_003898845.1.59147 WP_003898845.1.59166 WP_003898845.1.59205 WP_003898845.1.59209 WP_003898845.1.59237 WP_003898845.1.59240 WP_003898845.1.59253 WP_003898845.1.59254 WP_003898845.1.59262 WP_003898845.1.59270 WP_003898845.1.5928 WP_003898845.1.59304 WP_003898845.1.59305 WP_003898845.1.59309 WP_003898845.1.59326 WP_003898845.1.59328 WP_003898845.1.59333 WP_003898845.1.59338 WP_003898845.1.59428 WP_003898845.1.59487 WP_003898845.1.59537 WP_003898845.1.59561 WP_003898845.1.59677 WP_003898845.1.59722 WP_003898845.1.59727 WP_003898845.1.59732 WP_003898845.1.59738 WP_003898845.1.59750 WP_003898845.1.59757 WP_003898845.1.59761 WP_003898845.1.59808 WP_003898845.1.59850 WP_003898845.1.59860 WP_003898845.1.59861 WP_003898845.1.5987 WP_003898845.1.59878 WP_003898845.1.59888 WP_003898845.1.59952 WP_003898845.1.5996 WP_003898845.1.59961 WP_003898845.1.59974 WP_003898845.1.6000 WP_003898845.1.6003 WP_003898845.1.60047 WP_003898845.1.6007 WP_003898845.1.60091 WP_003898845.1.60121 WP_003898845.1.60125 WP_003898845.1.60135 WP_003898845.1.60139 WP_003898845.1.60152 WP_003898845.1.60171 WP_003898845.1.60197 WP_003898845.1.6020 WP_003898845.1.60205 WP_003898845.1.60207 WP_003898845.1.60215 WP_003898845.1.60217 WP_003898845.1.60267 WP_003898845.1.60288 WP_003898845.1.60291 WP_003898845.1.60301 WP_003898845.1.60305 WP_003898845.1.60312 WP_003898845.1.60313 WP_003898845.1.60314 WP_003898845.1.60367 WP_003898845.1.60376 WP_003898845.1.60403 WP_003898845.1.60413 WP_003898845.1.60421 WP_003898845.1.60451 WP_003898845.1.60460 WP_003898845.1.60487 WP_003898845.1.60512 WP_003898845.1.60573 WP_003898845.1.60583 WP_003898845.1.60632 WP_003898845.1.60657 WP_003898845.1.60687 WP_003898845.1.60689 WP_003898845.1.60727 WP_003898845.1.60738 WP_003898845.1.60763 WP_003898845.1.6077 WP_003898845.1.60791 WP_003898845.1.60834 WP_003898845.1.60870 WP_003898845.1.60878 WP_003898845.1.60879 WP_003898845.1.60913 WP_003898845.1.60978 WP_003898845.1.61000 WP_003898845.1.61001 WP_003898845.1.61012 WP_003898845.1.61014 WP_003898845.1.61015 WP_003898845.1.61037 WP_003898845.1.61052 WP_003898845.1.61065 WP_003898845.1.61100 WP_003898845.1.61101 WP_003898845.1.61138 WP_003898845.1.61142 WP_003898845.1.61198 WP_003898845.1.612 WP_003898845.1.61234 WP_003898845.1.61281 WP_003898845.1.61314 WP_003898845.1.61321 WP_003898845.1.61326 WP_003898845.1.61328 WP_003898845.1.61368 WP_003898845.1.61391 WP_003898845.1.61406 WP_003898845.1.61409 WP_003898845.1.61420 WP_003898845.1.61422 WP_003898845.1.61425 WP_003898845.1.61428 WP_003898845.1.61469 WP_003898845.1.61494 WP_003898845.1.61522 WP_003898845.1.61552 WP_003898845.1.61557 WP_003898845.1.61567 WP_003898845.1.61571 WP_003898845.1.61573 WP_003898845.1.61584 WP_003898845.1.61586 WP_003898845.1.6159 WP_003898845.1.61592 WP_003898845.1.6160 WP_003898845.1.61614 WP_003898845.1.6163 WP_003898845.1.61655 WP_003898845.1.61665 WP_003898845.1.61669 WP_003898845.1.61682 WP_003898845.1.61692 WP_003898845.1.61719 WP_003898845.1.61728 WP_003898845.1.61750 WP_003898845.1.61754 WP_003898845.1.61755 WP_003898845.1.61757 WP_003898845.1.6179 WP_003898845.1.61816 WP_003898845.1.61842 WP_003898845.1.61850 WP_003898845.1.61862 WP_003898845.1.61865 WP_003898845.1.61868 WP_003898845.1.61911 WP_003898845.1.61941 WP_003898845.1.61953 WP_003898845.1.61979 WP_003898845.1.61986 WP_003898845.1.61987 WP_003898845.1.61998 WP_003898845.1.62021 WP_003898845.1.62087 WP_003898845.1.62089 WP_003898845.1.62101 WP_003898845.1.62104 WP_003898845.1.6211 WP_003898845.1.62132 WP_003898845.1.62162 WP_003898845.1.62225 WP_003898845.1.62230 WP_003898845.1.62238 WP_003898845.1.62249 WP_003898845.1.62270 WP_003898845.1.62281 WP_003898845.1.62307 WP_003898845.1.6231 WP_003898845.1.62359 WP_003898845.1.62371 WP_003898845.1.62379 WP_003898845.1.62395 WP_003898845.1.62449 WP_003898845.1.62468 WP_003898845.1.6248 WP_003898845.1.62508 WP_003898845.1.62565 WP_003898845.1.62594 WP_003898845.1.62606 WP_003898845.1.62616 WP_003898845.1.62666 WP_003898845.1.62687 WP_003898845.1.62715 WP_003898845.1.62730 WP_003898845.1.62738 WP_003898845.1.62761 WP_003898845.1.62766 WP_003898845.1.62813 WP_003898845.1.62839 WP_003898845.1.62841 WP_003898845.1.62909 WP_003898845.1.62936 WP_003898845.1.6294 WP_003898845.1.6295 WP_003898845.1.62962 WP_003898845.1.63007 WP_003898845.1.63019 WP_003898845.1.63032 WP_003898845.1.63037 WP_003898845.1.63064 WP_003898845.1.63066 WP_003898845.1.63072 WP_003898845.1.6308 WP_003898845.1.63081 WP_003898845.1.63096 WP_003898845.1.63106 WP_003898845.1.6314 WP_003898845.1.63144 WP_003898845.1.63154 WP_003898845.1.63160 WP_003898845.1.63161 WP_003898845.1.63166 WP_003898845.1.63194 WP_003898845.1.63222 WP_003898845.1.6328 WP_003898845.1.63291 WP_003898845.1.63312 WP_003898845.1.63317 WP_003898845.1.63331 WP_003898845.1.63373 WP_003898845.1.63384 WP_003898845.1.63403 WP_003898845.1.63424 WP_003898845.1.63428 WP_003898845.1.6345 WP_003898845.1.63464 WP_003898845.1.63483 WP_003898845.1.63502 WP_003898845.1.63504 WP_003898845.1.63522 WP_003898845.1.63530 WP_003898845.1.63564 WP_003898845.1.63567 WP_003898845.1.63596 WP_003898845.1.63600 WP_003898845.1.63623 WP_003898845.1.63624 WP_003898845.1.63625 WP_003898845.1.63627 WP_003898845.1.63654 WP_003898845.1.63662 WP_003898845.1.63711 WP_003898845.1.63734 WP_003898845.1.63807 WP_003898845.1.63819 WP_003898845.1.63844 WP_003898845.1.63888 WP_003898845.1.63913 WP_003898845.1.63915 WP_003898845.1.63918 WP_003898845.1.63961 WP_003898845.1.63970 WP_003898845.1.64000 WP_003898845.1.64027 WP_003898845.1.64058 WP_003898845.1.64065 WP_003898845.1.6407 WP_003898845.1.64082 WP_003898845.1.64091 WP_003898845.1.64102 WP_003898845.1.64104 WP_003898845.1.64169 WP_003898845.1.64219 WP_003898845.1.6422 WP_003898845.1.64222 WP_003898845.1.64228 WP_003898845.1.64235 WP_003898845.1.64249 WP_003898845.1.6427 WP_003898845.1.64278 WP_003898845.1.64287 WP_003898845.1.64414 WP_003898845.1.64419 WP_003898845.1.6443 WP_003898845.1.64463 WP_003898845.1.64480 WP_003898845.1.64497 WP_003898845.1.64506 WP_003898845.1.64511 WP_003898845.1.64513 WP_003898845.1.64514 WP_003898845.1.64515 WP_003898845.1.64522 WP_003898845.1.64526 WP_003898845.1.64543 WP_003898845.1.6456 WP_003898845.1.64567 WP_003898845.1.64588 WP_003898845.1.64589 WP_003898845.1.64594 WP_003898845.1.64595 WP_003898845.1.64608 WP_003898845.1.64619 WP_003898845.1.64629 WP_003898845.1.6464 WP_003898845.1.64664 WP_003898845.1.64669 WP_003898845.1.64672 WP_003898845.1.64680 WP_003898845.1.64682 WP_003898845.1.64727 WP_003898845.1.64729 WP_003898845.1.64776 WP_003898845.1.64832 WP_003898845.1.6486 WP_003898845.1.64870 WP_003898845.1.64898 WP_003898845.1.64922 WP_003898845.1.64924 WP_003898845.1.6493 WP_003898845.1.64941 WP_003898845.1.64973 WP_003898845.1.65001 WP_003898845.1.65026 WP_003898845.1.65070 WP_003898845.1.65079 WP_003898845.1.65102 WP_003898845.1.65157 WP_003898845.1.65181 WP_003898845.1.65212 WP_003898845.1.65229 WP_003898845.1.6523 WP_003898845.1.65253 WP_003898845.1.65289 WP_003898845.1.65291 WP_003898845.1.65315 WP_003898845.1.65359 WP_003898845.1.6536 WP_003898845.1.65374 WP_003898845.1.65386 WP_003898845.1.65414 WP_003898845.1.65416 WP_003898845.1.65433 WP_003898845.1.65455 WP_003898845.1.65467 WP_003898845.1.65488 WP_003898845.1.65529 WP_003898845.1.65539 WP_003898845.1.65583 WP_003898845.1.65612 WP_003898845.1.65623 WP_003898845.1.65635 WP_003898845.1.65637 WP_003898845.1.65648 WP_003898845.1.65683 WP_003898845.1.65686 WP_003898845.1.65688 WP_003898845.1.65707 WP_003898845.1.65733 WP_003898845.1.65746 WP_003898845.1.65747 WP_003898845.1.65759 WP_003898845.1.65816 WP_003898845.1.65830 WP_003898845.1.65858 WP_003898845.1.65862 WP_003898845.1.65869 WP_003898845.1.65893 WP_003898845.1.65929 WP_003898845.1.65932 WP_003898845.1.65958 WP_003898845.1.65974 WP_003898845.1.66004 WP_003898845.1.6606 WP_003898845.1.66089 WP_003898845.1.66149 WP_003898845.1.66151 WP_003898845.1.66276 WP_003898845.1.66293 WP_003898845.1.66297 WP_003898845.1.66323 WP_003898845.1.66325 WP_003898845.1.6633 WP_003898845.1.66334 WP_003898845.1.66355 WP_003898845.1.66367 WP_003898845.1.66394 WP_003898845.1.66396 WP_003898845.1.66451 WP_003898845.1.66455 WP_003898845.1.66457 WP_003898845.1.66464 WP_003898845.1.66466 WP_003898845.1.66487 WP_003898845.1.66504 WP_003898845.1.66544 WP_003898845.1.66558 WP_003898845.1.66580 WP_003898845.1.66582 WP_003898845.1.66612 WP_003898845.1.66617 WP_003898845.1.66635 WP_003898845.1.66656 WP_003898845.1.66663 WP_003898845.1.66675 WP_003898845.1.66715 WP_003898845.1.66718 WP_003898845.1.66762 WP_003898845.1.66776 WP_003898845.1.66808 WP_003898845.1.66817 WP_003898845.1.66819 WP_003898845.1.66826 WP_003898845.1.66830 WP_003898845.1.66842 WP_003898845.1.66868 WP_003898845.1.66878 WP_003898845.1.66880 WP_003898845.1.66893 WP_003898845.1.66961 WP_003898845.1.67005 WP_003898845.1.6704 WP_003898845.1.67044 WP_003898845.1.67061 WP_003898845.1.67089 WP_003898845.1.67098 WP_003898845.1.67146 WP_003898845.1.67170 WP_003898845.1.67197 WP_003898845.1.67198 WP_003898845.1.6720 WP_003898845.1.67207 WP_003898845.1.67218 WP_003898845.1.67220 WP_003898845.1.67225 WP_003898845.1.67231 WP_003898845.1.6724 WP_003898845.1.67257 WP_003898845.1.67298 WP_003898845.1.67307 WP_003898845.1.67324 WP_003898845.1.67332 WP_003898845.1.67346 WP_003898845.1.67360 WP_003898845.1.67381 WP_003898845.1.67396 WP_003898845.1.67417 WP_003898845.1.67422 WP_003898845.1.67453 WP_003898845.1.67459 WP_003898845.1.6746 WP_003898845.1.67473 WP_003898845.1.67482 WP_003898845.1.67496 WP_003898845.1.67499 WP_003898845.1.67523 WP_003898845.1.67536 WP_003898845.1.67575 WP_003898845.1.67587 WP_003898845.1.67598 WP_003898845.1.67600 WP_003898845.1.67602 WP_003898845.1.67630 WP_003898845.1.67679 WP_003898845.1.67692 WP_003898845.1.67744 WP_003898845.1.6775 WP_003898845.1.67750 WP_003898845.1.6777 WP_003898845.1.67816 WP_003898845.1.67844 WP_003898845.1.67848 WP_003898845.1.67870 WP_003898845.1.67888 WP_003898845.1.67915 WP_003898845.1.67945 WP_003898845.1.67949 WP_003898845.1.67980 WP_003898845.1.67982 WP_003898845.1.68022 WP_003898845.1.68029 WP_003898845.1.68037 WP_003898845.1.68038 WP_003898845.1.68045 WP_003898845.1.68057 WP_003898845.1.68083 WP_003898845.1.68088 WP_003898845.1.68106 WP_003898845.1.68110 WP_003898845.1.68153 WP_003898845.1.68169 WP_003898845.1.68193 WP_003898845.1.68212 WP_003898845.1.68227 WP_003898845.1.68243 WP_003898845.1.6825 WP_003898845.1.68297 WP_003898845.1.68309 WP_003898845.1.68325 WP_003898845.1.68329 WP_003898845.1.68340 WP_003898845.1.68384 WP_003898845.1.68388 WP_003898845.1.68429 WP_003898845.1.6843 WP_003898845.1.68433 WP_003898845.1.68444 WP_003898845.1.68465 WP_003898845.1.68484 WP_003898845.1.68518 WP_003898845.1.68569 WP_003898845.1.68576 WP_003898845.1.68580 WP_003898845.1.68586 WP_003898845.1.68623 WP_003898845.1.68637 WP_003898845.1.68646 WP_003898845.1.68667 WP_003898845.1.68669 WP_003898845.1.68672 WP_003898845.1.68684 WP_003898845.1.68704 WP_003898845.1.68708 WP_003898845.1.6872 WP_003898845.1.68730 WP_003898845.1.68734 WP_003898845.1.68748 WP_003898845.1.68754 WP_003898845.1.6876 WP_003898845.1.68761 WP_003898845.1.68763 WP_003898845.1.68766 WP_003898845.1.68774 WP_003898845.1.68796 WP_003898845.1.68824 WP_003898845.1.68832 WP_003898845.1.68833 WP_003898845.1.68841 WP_003898845.1.68859 WP_003898845.1.68876 WP_003898845.1.68906 WP_003898845.1.68916 WP_003898845.1.68923 WP_003898845.1.68945 WP_003898845.1.6896 WP_003898845.1.68981 WP_003898845.1.68984 WP_003898845.1.68997 WP_003898845.1.69076 WP_003898845.1.69079 WP_003898845.1.6908 WP_003898845.1.69082 WP_003898845.1.69178 WP_003898845.1.69208 WP_003898845.1.69231 WP_003898845.1.69256 WP_003898845.1.69311 WP_003898845.1.69315 WP_003898845.1.69322 WP_003898845.1.69342 WP_003898845.1.6936 WP_003898845.1.69369 WP_003898845.1.69374 WP_003898845.1.69398 WP_003898845.1.69401 WP_003898845.1.69426 WP_003898845.1.69427 WP_003898845.1.69429 WP_003898845.1.6949 WP_003898845.1.6951 WP_003898845.1.69511 WP_003898845.1.69526 WP_003898845.1.69528 WP_003898845.1.69547 WP_003898845.1.69573 WP_003898845.1.69581 WP_003898845.1.6960 WP_003898845.1.69617 WP_003898845.1.69634 WP_003898845.1.69647 WP_003898845.1.69659 WP_003898845.1.69673 WP_003898845.1.69682 WP_003898845.1.69684 WP_003898845.1.69686 WP_003898845.1.69707 WP_003898845.1.69709 WP_003898845.1.69723 WP_003898845.1.69736 WP_003898845.1.69778 WP_003898845.1.69800 WP_003898845.1.69802 WP_003898845.1.69845 WP_003898845.1.69870 WP_003898845.1.69873 WP_003898845.1.69898 WP_003898845.1.69913 WP_003898845.1.69925 WP_003898845.1.69931 WP_003898845.1.69938 WP_003898845.1.69955 WP_003898845.1.69957 WP_003898845.1.69981 WP_003898845.1.69990 WP_003898845.1.70 WP_003898845.1.70000 WP_003898845.1.70017 WP_003898845.1.70032 WP_003898845.1.70055 WP_003898845.1.70062 WP_003898845.1.70072 WP_003898845.1.70131 WP_003898845.1.70132 WP_003898845.1.7022 WP_003898845.1.70227 WP_003898845.1.70255 WP_003898845.1.70271 WP_003898845.1.70274 WP_003898845.1.7029 WP_003898845.1.70325 WP_003898845.1.70328 WP_003898845.1.70356 WP_003898845.1.70364 WP_003898845.1.70368 WP_003898845.1.70369 WP_003898845.1.70418 WP_003898845.1.70422 WP_003898845.1.70435 WP_003898845.1.70444 WP_003898845.1.70463 WP_003898845.1.70471 WP_003898845.1.70480 WP_003898845.1.70494 WP_003898845.1.70498 WP_003898845.1.70525 WP_003898845.1.70573 WP_003898845.1.70577 WP_003898845.1.70610 WP_003898845.1.70615 WP_003898845.1.70618 WP_003898845.1.70622 WP_003898845.1.70626 WP_003898845.1.70668 WP_003898845.1.70699 WP_003898845.1.70704 WP_003898845.1.70729 WP_003898845.1.70757 WP_003898845.1.70782 WP_003898845.1.70796 WP_003898845.1.70830 WP_003898845.1.70834 WP_003898845.1.7084 WP_003898845.1.70840 WP_003898845.1.70864 WP_003898845.1.70871 WP_003898845.1.70915 WP_003898845.1.70958 WP_003898845.1.70964 WP_003898845.1.70976 WP_003898845.1.71015 WP_003898845.1.71063 WP_003898845.1.71076 WP_003898845.1.71083 WP_003898845.1.7111 WP_003898845.1.71118 WP_003898845.1.7113 WP_003898845.1.71187 WP_003898845.1.71191 WP_003898845.1.71255 WP_003898845.1.71258 WP_003898845.1.71259 WP_003898845.1.71289 WP_003898845.1.71326 WP_003898845.1.71329 WP_003898845.1.71331 WP_003898845.1.71344 WP_003898845.1.71390 WP_003898845.1.71399 WP_003898845.1.71414 WP_003898845.1.71440 WP_003898845.1.71457 WP_003898845.1.71464 WP_003898845.1.71490 WP_003898845.1.71492 WP_003898845.1.71509 WP_003898845.1.71516 WP_003898845.1.71517 WP_003898845.1.71527 WP_003898845.1.71532 WP_003898845.1.71545 WP_003898845.1.71546 WP_003898845.1.71569 WP_003898845.1.71604 WP_003898845.1.71630 WP_003898845.1.71638 WP_003898845.1.71654 WP_003898845.1.71664 WP_003898845.1.71665 WP_003898845.1.71683 WP_003898845.1.71701 WP_003898845.1.71718 WP_003898845.1.71731 WP_003898845.1.71778 WP_003898845.1.71781 WP_003898845.1.71803 WP_003898845.1.71847 WP_003898845.1.7185 WP_003898845.1.71851 WP_003898845.1.71871 WP_003898845.1.71909 WP_003898845.1.71957 WP_003898845.1.71970 WP_003898845.1.72047 WP_003898845.1.72061 WP_003898845.1.72062 WP_003898845.1.72072 WP_003898845.1.72111 WP_003898845.1.72122 WP_003898845.1.72128 WP_003898845.1.72143 WP_003898845.1.72168 WP_003898845.1.72179 WP_003898845.1.72209 WP_003898845.1.72227 WP_003898845.1.7224 WP_003898845.1.72268 WP_003898845.1.72332 WP_003898845.1.72380 WP_003898845.1.72401 WP_003898845.1.72405 WP_003898845.1.72420 WP_003898845.1.72441 WP_003898845.1.72451 WP_003898845.1.72452 WP_003898845.1.72457 WP_003898845.1.72459 WP_003898845.1.72460 WP_003898845.1.72466 WP_003898845.1.72487 WP_003898845.1.72488 WP_003898845.1.72492 WP_003898845.1.72506 WP_003898845.1.72543 WP_003898845.1.7256 WP_003898845.1.72576 WP_003898845.1.72578 WP_003898845.1.72585 WP_003898845.1.72591 WP_003898845.1.72592 WP_003898845.1.72640 WP_003898845.1.72661 WP_003898845.1.72684 WP_003898845.1.72739 WP_003898845.1.72744 WP_003898845.1.72755 WP_003898845.1.72759 WP_003898845.1.72784 WP_003898845.1.72792 WP_003898845.1.72826 WP_003898845.1.72831 WP_003898845.1.72852 WP_003898845.1.72853 WP_003898845.1.72879 WP_003898845.1.72880 WP_003898845.1.72938 WP_003898845.1.72954 WP_003898845.1.72957 WP_003898845.1.72959 WP_003898845.1.72982 WP_003898845.1.72988 WP_003898845.1.72993 WP_003898845.1.73006 WP_003898845.1.73013 WP_003898845.1.73025 WP_003898845.1.73028 WP_003898845.1.73042 WP_003898845.1.73045 WP_003898845.1.73092 WP_003898845.1.73118 WP_003898845.1.7312 WP_003898845.1.73127 WP_003898845.1.73134 WP_003898845.1.73154 WP_003898845.1.73163 WP_003898845.1.73182 WP_003898845.1.73205 WP_003898845.1.7321 WP_003898845.1.73310 WP_003898845.1.73365 WP_003898845.1.73391 WP_003898845.1.73404 WP_003898845.1.73424 WP_003898845.1.73436 WP_003898845.1.73445 WP_003898845.1.73453 WP_003898845.1.73465 WP_003898845.1.73466 WP_003898845.1.73470 WP_003898845.1.73471 WP_003898845.1.73478 WP_003898845.1.73482 WP_003898845.1.73507 WP_003898845.1.73532 WP_003898845.1.73550 WP_003898845.1.73564 WP_003898845.1.73623 WP_003898845.1.73629 WP_003898845.1.73644 WP_003898845.1.7366 WP_003898845.1.73661 WP_003898845.1.7368 WP_003898845.1.73688 WP_003898845.1.73723 WP_003898845.1.73744 WP_003898845.1.73750 WP_003898845.1.73760 WP_003898845.1.73774 WP_003898845.1.7379 WP_003898845.1.73813 WP_003898845.1.73840 WP_003898845.1.73876 WP_003898845.1.7389 WP_003898845.1.73986 WP_003898845.1.74016 WP_003898845.1.74039 WP_003898845.1.74083 WP_003898845.1.74101 WP_003898845.1.74107 WP_003898845.1.74129 WP_003898845.1.74144 WP_003898845.1.7417 WP_003898845.1.74190 WP_003898845.1.74210 WP_003898845.1.7423 WP_003898845.1.74259 WP_003898845.1.74262 WP_003898845.1.74269 WP_003898845.1.74282 WP_003898845.1.74291 WP_003898845.1.74296 WP_003898845.1.74304 WP_003898845.1.7432 WP_003898845.1.74347 WP_003898845.1.7436 WP_003898845.1.74378 WP_003898845.1.74382 WP_003898845.1.74395 WP_003898845.1.74400 WP_003898845.1.74432 WP_003898845.1.74442 WP_003898845.1.74487 WP_003898845.1.74499 WP_003898845.1.74504 WP_003898845.1.74511 WP_003898845.1.74523 WP_003898845.1.74525 WP_003898845.1.74551 WP_003898845.1.74555 WP_003898845.1.74628 WP_003898845.1.74641 WP_003898845.1.74653 WP_003898845.1.74660 WP_003898845.1.74683 WP_003898845.1.7469 WP_003898845.1.74725 WP_003898845.1.74760 WP_003898845.1.74786 WP_003898845.1.74809 WP_003898845.1.74820 WP_003898845.1.74870 WP_003898845.1.74881 WP_003898845.1.74888 WP_003898845.1.74952 WP_003898845.1.7496 WP_003898845.1.74988 WP_003898845.1.75043 WP_003898845.1.75055 WP_003898845.1.75078 WP_003898845.1.75081 WP_003898845.1.75120 WP_003898845.1.75163 WP_003898845.1.75188 WP_003898845.1.75200 WP_003898845.1.75202 WP_003898845.1.75234 WP_003898845.1.75239 WP_003898845.1.75263 WP_003898845.1.75342 WP_003898845.1.7535 WP_003898845.1.75376 WP_003898845.1.75391 WP_003898845.1.75395 WP_003898845.1.75441 WP_003898845.1.75510 WP_003898845.1.75581 WP_003898845.1.75598 WP_003898845.1.75635 WP_003898845.1.75665 WP_003898845.1.75671 WP_003898845.1.75741 WP_003898845.1.75749 WP_003898845.1.75772 WP_003898845.1.75774 WP_003898845.1.75811 WP_003898845.1.75833 WP_003898845.1.7585 WP_003898845.1.75864 WP_003898845.1.75868 WP_003898845.1.75878 WP_003898845.1.75927 WP_003898845.1.75946 WP_003898845.1.75968 WP_003898845.1.75974 WP_003898845.1.76016 WP_003898845.1.76032 WP_003898845.1.76037 WP_003898845.1.7604 WP_003898845.1.76045 WP_003898845.1.76052 WP_003898845.1.76058 WP_003898845.1.76064 WP_003898845.1.76110 WP_003898845.1.76126 WP_003898845.1.76133 WP_003898845.1.76138 WP_003898845.1.76157 WP_003898845.1.76172 WP_003898845.1.76177 WP_003898845.1.76183 WP_003898845.1.76209 WP_003898845.1.76239 WP_003898845.1.76272 WP_003898845.1.76277 WP_003898845.1.76281 WP_003898845.1.76291 WP_003898845.1.76297 WP_003898845.1.76360 WP_003898845.1.76379 WP_003898845.1.76403 WP_003898845.1.76413 WP_003898845.1.76414 WP_003898845.1.76427 WP_003898845.1.76436 WP_003898845.1.76442 WP_003898845.1.76443 WP_003898845.1.76456 WP_003898845.1.76533 WP_003898845.1.76616 WP_003898845.1.76625 WP_003898845.1.76629 WP_003898845.1.76635 WP_003898845.1.76638 WP_003898845.1.76640 WP_003898845.1.76644 WP_003898845.1.76677 WP_003898845.1.76678 WP_003898845.1.76679 WP_003898845.1.76734 WP_003898845.1.76744 WP_003898845.1.76750 WP_003898845.1.76754 WP_003898845.1.76757 WP_003898845.1.76781 WP_003898845.1.76818 WP_003898845.1.76824 WP_003898845.1.76835 WP_003898845.1.76873 WP_003898845.1.76881 WP_003898845.1.76888 WP_003898845.1.76900 WP_003898845.1.7691 WP_003898845.1.76947 WP_003898845.1.76954 WP_003898845.1.76955 WP_003898845.1.76963 WP_003898845.1.770 WP_003898845.1.77000 WP_003898845.1.77008 WP_003898845.1.77021 WP_003898845.1.77056 WP_003898845.1.77065 WP_003898845.1.77075 WP_003898845.1.77107 WP_003898845.1.77115 WP_003898845.1.77118 WP_003898845.1.77125 WP_003898845.1.77141 WP_003898845.1.77142 WP_003898845.1.77250 WP_003898845.1.77260 WP_003898845.1.77266 WP_003898845.1.77285 WP_003898845.1.77312 WP_003898845.1.77348 WP_003898845.1.77351 WP_003898845.1.77352 WP_003898845.1.77361 WP_003898845.1.774 WP_003898845.1.77404 WP_003898845.1.77425 WP_003898845.1.77463 WP_003898845.1.77474 WP_003898845.1.7748 WP_003898845.1.77484 WP_003898845.1.77491 WP_003898845.1.77499 WP_003898845.1.77510 WP_003898845.1.77530 WP_003898845.1.77554 WP_003898845.1.77559 WP_003898845.1.77599 WP_003898845.1.7762 WP_003898845.1.77627 WP_003898845.1.77649 WP_003898845.1.77654 WP_003898845.1.7766 WP_003898845.1.77667 WP_003898845.1.77704 WP_003898845.1.77706 WP_003898845.1.77726 WP_003898845.1.77774 WP_003898845.1.7778 WP_003898845.1.77790 WP_003898845.1.77809 WP_003898845.1.77820 WP_003898845.1.77843 WP_003898845.1.77855 WP_003898845.1.77865 WP_003898845.1.77868 WP_003898845.1.77890 WP_003898845.1.77909 WP_003898845.1.77911 WP_003898845.1.77931 WP_003898845.1.77984 WP_003898845.1.78020 WP_003898845.1.78024 WP_003898845.1.78075 WP_003898845.1.78086 WP_003898845.1.7809 WP_003898845.1.78098 WP_003898845.1.78105 WP_003898845.1.78113 WP_003898845.1.78136 WP_003898845.1.78162 WP_003898845.1.7817 WP_003898845.1.78200 WP_003898845.1.78216 WP_003898845.1.78236 WP_003898845.1.78238 WP_003898845.1.78322 WP_003898845.1.78338 WP_003898845.1.7836 WP_003898845.1.78360 WP_003898845.1.78386 WP_003898845.1.78435 WP_003898845.1.7844 WP_003898845.1.78459 WP_003898845.1.78488 WP_003898845.1.7849 WP_003898845.1.78499 WP_003898845.1.785 WP_003898845.1.78516 WP_003898845.1.78524 WP_003898845.1.78526 WP_003898845.1.78538 WP_003898845.1.78545 WP_003898845.1.78547 WP_003898845.1.78574 WP_003898845.1.78580 WP_003898845.1.7860 WP_003898845.1.78620 WP_003898845.1.78646 WP_003898845.1.78648 WP_003898845.1.78649 WP_003898845.1.78655 WP_003898845.1.78657 WP_003898845.1.78659 WP_003898845.1.7869 WP_003898845.1.78692 WP_003898845.1.78760 WP_003898845.1.78766 WP_003898845.1.78776 WP_003898845.1.78778 WP_003898845.1.78784 WP_003898845.1.78788 WP_003898845.1.78790 WP_003898845.1.78860 WP_003898845.1.7887 WP_003898845.1.78884 WP_003898845.1.78932 WP_003898845.1.78969 WP_003898845.1.78977 WP_003898845.1.78980 WP_003898845.1.79005 WP_003898845.1.79016 WP_003898845.1.79033 WP_003898845.1.79064 WP_003898845.1.79066 WP_003898845.1.79068 WP_003898845.1.79095 WP_003898845.1.79112 WP_003898845.1.79122 WP_003898845.1.79145 WP_003898845.1.79152 WP_003898845.1.79163 WP_003898845.1.79182 WP_003898845.1.79198 WP_003898845.1.79213 WP_003898845.1.79218 WP_003898845.1.79268 WP_003898845.1.79278 WP_003898845.1.79290 WP_003898845.1.79319 WP_003898845.1.79325 WP_003898845.1.79326 WP_003898845.1.7933 WP_003898845.1.79330 WP_003898845.1.79339 WP_003898845.1.79394 WP_003898845.1.79399 WP_003898845.1.79413 WP_003898845.1.79422 WP_003898845.1.79445 WP_003898845.1.79447 WP_003898845.1.79455 WP_003898845.1.79471 WP_003898845.1.79480 WP_003898845.1.79482 WP_003898845.1.79488 WP_003898845.1.79500 WP_003898845.1.79502 WP_003898845.1.79508 WP_003898845.1.79514 WP_003898845.1.79561 WP_003898845.1.79565 WP_003898845.1.79578 WP_003898845.1.79588 WP_003898845.1.79598 WP_003898845.1.79615 WP_003898845.1.79684 WP_003898845.1.79698 WP_003898845.1.797 WP_003898845.1.79744 WP_003898845.1.79784 WP_003898845.1.79806 WP_003898845.1.79819 WP_003898845.1.79826 WP_003898845.1.79828 WP_003898845.1.79853 WP_003898845.1.79863 WP_003898845.1.79881 WP_003898845.1.79885 WP_003898845.1.79898 WP_003898845.1.7990 WP_003898845.1.79900 WP_003898845.1.79913 WP_003898845.1.79918 WP_003898845.1.79947 WP_003898845.1.79948 WP_003898845.1.7995 WP_003898845.1.7997 WP_003898845.1.80004 WP_003898845.1.80015 WP_003898845.1.80022 WP_003898845.1.80030 WP_003898845.1.80054 WP_003898845.1.80084 WP_003898845.1.80099 WP_003898845.1.80129 WP_003898845.1.80177 WP_003898845.1.80234 WP_003898845.1.8026 WP_003898845.1.80275 WP_003898845.1.8029 WP_003898845.1.80299 WP_003898845.1.80304 WP_003898845.1.80326 WP_003898845.1.8037 WP_003898845.1.80370 WP_003898845.1.80387 WP_003898845.1.80399 WP_003898845.1.8044 WP_003898845.1.80451 WP_003898845.1.80458 WP_003898845.1.80461 WP_003898845.1.80490 WP_003898845.1.80503 WP_003898845.1.80507 WP_003898845.1.80552 WP_003898845.1.80576 WP_003898845.1.80588 WP_003898845.1.80599 WP_003898845.1.8060 WP_003898845.1.80624 WP_003898845.1.80636 WP_003898845.1.80673 WP_003898845.1.80711 WP_003898845.1.80714 WP_003898845.1.80743 WP_003898845.1.80784 WP_003898845.1.80815 WP_003898845.1.80853 WP_003898845.1.80918 WP_003898845.1.8093 WP_003898845.1.80967 WP_003898845.1.8097 WP_003898845.1.80988 WP_003898845.1.81007 WP_003898845.1.81013 WP_003898845.1.8105 WP_003898845.1.81059 WP_003898845.1.81063 WP_003898845.1.81066 WP_003898845.1.81075 WP_003898845.1.81091 WP_003898845.1.81119 WP_003898845.1.81125 WP_003898845.1.81136 WP_003898845.1.8114 WP_003898845.1.81189 WP_003898845.1.81192 WP_003898845.1.812 WP_003898845.1.81230 WP_003898845.1.81249 WP_003898845.1.81250 WP_003898845.1.81264 WP_003898845.1.8128 WP_003898845.1.81287 WP_003898845.1.81297 WP_003898845.1.8138 WP_003898845.1.81407 WP_003898845.1.8143 WP_003898845.1.81439 WP_003898845.1.81465 WP_003898845.1.81529 WP_003898845.1.81538 WP_003898845.1.81541 WP_003898845.1.81560 WP_003898845.1.81561 WP_003898845.1.81567 WP_003898845.1.81583 WP_003898845.1.81686 WP_003898845.1.81712 WP_003898845.1.81720 WP_003898845.1.81731 WP_003898845.1.81774 WP_003898845.1.81788 WP_003898845.1.81820 WP_003898845.1.81850 WP_003898845.1.81883 WP_003898845.1.81891 WP_003898845.1.81911 WP_003898845.1.81918 WP_003898845.1.82011 WP_003898845.1.82048 WP_003898845.1.82069 WP_003898845.1.82071 WP_003898845.1.82108 WP_003898845.1.82136 WP_003898845.1.82142 WP_003898845.1.8215 WP_003898845.1.82158 WP_003898845.1.8217 WP_003898845.1.82209 WP_003898845.1.82210 WP_003898845.1.82228 WP_003898845.1.82236 WP_003898845.1.82251 WP_003898845.1.82271 WP_003898845.1.82305 WP_003898845.1.82307 WP_003898845.1.82317 WP_003898845.1.8232 WP_003898845.1.82346 WP_003898845.1.82374 WP_003898845.1.82385 WP_003898845.1.82429 WP_003898845.1.82460 WP_003898845.1.82483 WP_003898845.1.82494 WP_003898845.1.82531 WP_003898845.1.82546 WP_003898845.1.82547 WP_003898845.1.82549 WP_003898845.1.82577 WP_003898845.1.82592 WP_003898845.1.82597 WP_003898845.1.82598 WP_003898845.1.82625 WP_003898845.1.82642 WP_003898845.1.82651 WP_003898845.1.82653 WP_003898845.1.82681 WP_003898845.1.82685 WP_003898845.1.8271 WP_003898845.1.82712 WP_003898845.1.8273 WP_003898845.1.82743 WP_003898845.1.82757 WP_003898845.1.82774 WP_003898845.1.82803 WP_003898845.1.82860 WP_003898845.1.82871 WP_003898845.1.82935 WP_003898845.1.82957 WP_003898845.1.82981 WP_003898845.1.82983 WP_003898845.1.83004 WP_003898845.1.83009 WP_003898845.1.83044 WP_003898845.1.83065 WP_003898845.1.83074 WP_003898845.1.83146 WP_003898845.1.83149 WP_003898845.1.83159 WP_003898845.1.8317 WP_003898845.1.83173 WP_003898845.1.83181 WP_003898845.1.83182 WP_003898845.1.83191 WP_003898845.1.83197 WP_003898845.1.83212 WP_003898845.1.83262 WP_003898845.1.83273 WP_003898845.1.83309 WP_003898845.1.83332 WP_003898845.1.83334 WP_003898845.1.83341 WP_003898845.1.83349 WP_003898845.1.8335 WP_003898845.1.83353 WP_003898845.1.83367 WP_003898845.1.83380 WP_003898845.1.83381 WP_003898845.1.83389 WP_003898845.1.83408 WP_003898845.1.83409 WP_003898845.1.83435 WP_003898845.1.83470 WP_003898845.1.83524 WP_003898845.1.83526 WP_003898845.1.8358 WP_003898845.1.83589 WP_003898845.1.83601 WP_003898845.1.83611 WP_003898845.1.83638 WP_003898845.1.83656 WP_003898845.1.83667 WP_003898845.1.83689 WP_003898845.1.83692 WP_003898845.1.83705 WP_003898845.1.83766 WP_003898845.1.83793 WP_003898845.1.83794 WP_003898845.1.83802 WP_003898845.1.83805 WP_003898845.1.83839 WP_003898845.1.83842 WP_003898845.1.83850 WP_003898845.1.83861 WP_003898845.1.83884 WP_003898845.1.83920 WP_003898845.1.83929 WP_003898845.1.83930 WP_003898845.1.83975 WP_003898845.1.83991 WP_003898845.1.8400 WP_003898845.1.84027 WP_003898845.1.8404 WP_003898845.1.84057 WP_003898845.1.84070 WP_003898845.1.8409 WP_003898845.1.84112 WP_003898845.1.84146 WP_003898845.1.8415 WP_003898845.1.84176 WP_003898845.1.84192 WP_003898845.1.84228 WP_003898845.1.8424 WP_003898845.1.84244 WP_003898845.1.84259 WP_003898845.1.8426 WP_003898845.1.84277 WP_003898845.1.84287 WP_003898845.1.8434 WP_003898845.1.84388 WP_003898845.1.84409 WP_003898845.1.84438 WP_003898845.1.84460 WP_003898845.1.84488 WP_003898845.1.84504 WP_003898845.1.84525 WP_003898845.1.84620 WP_003898845.1.84623 WP_003898845.1.84641 WP_003898845.1.84655 WP_003898845.1.84666 WP_003898845.1.84670 WP_003898845.1.84739 WP_003898845.1.84748 WP_003898845.1.84766 WP_003898845.1.84772 WP_003898845.1.84774 WP_003898845.1.848 WP_003898845.1.84836 WP_003898845.1.84839 WP_003898845.1.84846 WP_003898845.1.84873 WP_003898845.1.84938 WP_003898845.1.84968 WP_003898845.1.84973 WP_003898845.1.84981 WP_003898845.1.84985 WP_003898845.1.8503 WP_003898845.1.85038 WP_003898845.1.85043 WP_003898845.1.8505 WP_003898845.1.85074 WP_003898845.1.8509 WP_003898845.1.8512 WP_003898845.1.85148 WP_003898845.1.8518 WP_003898845.1.8522 WP_003898845.1.85242 WP_003898845.1.85276 WP_003898845.1.85281 WP_003898845.1.85284 WP_003898845.1.85314 WP_003898845.1.85319 WP_003898845.1.85330 WP_003898845.1.85341 WP_003898845.1.8535 WP_003898845.1.85363 WP_003898845.1.85371 WP_003898845.1.85377 WP_003898845.1.85399 WP_003898845.1.85458 WP_003898845.1.8546 WP_003898845.1.85478 WP_003898845.1.85480 WP_003898845.1.85488 WP_003898845.1.85495 WP_003898845.1.85551 WP_003898845.1.85557 WP_003898845.1.85577 WP_003898845.1.85599 WP_003898845.1.85610 WP_003898845.1.8563 WP_003898845.1.85648 WP_003898845.1.85679 WP_003898845.1.85704 WP_003898845.1.85717 WP_003898845.1.85727 WP_003898845.1.85737 WP_003898845.1.85763 WP_003898845.1.85808 WP_003898845.1.85819 WP_003898845.1.85820 WP_003898845.1.85823 WP_003898845.1.85832 WP_003898845.1.8586 WP_003898845.1.85872 WP_003898845.1.85894 WP_003898845.1.85909 WP_003898845.1.85913 WP_003898845.1.85953 WP_003898845.1.85986 WP_003898845.1.86000 WP_003898845.1.86024 WP_003898845.1.86025 WP_003898845.1.86032 WP_003898845.1.86048 WP_003898845.1.86052 WP_003898845.1.86067 WP_003898845.1.86103 WP_003898845.1.86122 WP_003898845.1.86124 WP_003898845.1.86160 WP_003898845.1.86164 WP_003898845.1.86168 WP_003898845.1.86190 WP_003898845.1.86204 WP_003898845.1.86208 WP_003898845.1.86235 WP_003898845.1.86249 WP_003898845.1.86260 WP_003898845.1.86290 WP_003898845.1.863 WP_003898845.1.86327 WP_003898845.1.86334 WP_003898845.1.86337 WP_003898845.1.86368 WP_003898845.1.86377 WP_003898845.1.86425 WP_003898845.1.86459 WP_003898845.1.8649 WP_003898845.1.86499 WP_003898845.1.86520 WP_003898845.1.86561 WP_003898845.1.86568 WP_003898845.1.86575 WP_003898845.1.86584 WP_003898845.1.86605 WP_003898845.1.86626 WP_003898845.1.86648 WP_003898845.1.86684 WP_003898845.1.86696 WP_003898845.1.86705 WP_003898845.1.86718 WP_003898845.1.86725 WP_003898845.1.86757 WP_003898845.1.86766 WP_003898845.1.86801 WP_003898845.1.86814 WP_003898845.1.86820 WP_003898845.1.86825 WP_003898845.1.86834 WP_003898845.1.8685 WP_003898845.1.86851 WP_003898845.1.86855 WP_003898845.1.86867 WP_003898845.1.86877 WP_003898845.1.86883 WP_003898845.1.86892 WP_003898845.1.86933 WP_003898845.1.86941 WP_003898845.1.86950 WP_003898845.1.86962 WP_003898845.1.86963 WP_003898845.1.86979 WP_003898845.1.8700 WP_003898845.1.87002 WP_003898845.1.87031 WP_003898845.1.87116 WP_003898845.1.87117 WP_003898845.1.8714 WP_003898845.1.87178 WP_003898845.1.87191 WP_003898845.1.87201 WP_003898845.1.87209 WP_003898845.1.87240 WP_003898845.1.87266 WP_003898845.1.87273 WP_003898845.1.87275 WP_003898845.1.8733 WP_003898845.1.87345 WP_003898845.1.87369 WP_003898845.1.8737 WP_003898845.1.87401 WP_003898845.1.87404 WP_003898845.1.87409 WP_003898845.1.87444 WP_003898845.1.87446 WP_003898845.1.87459 WP_003898845.1.87472 WP_003898845.1.87489 WP_003898845.1.87494 WP_003898845.1.87496 WP_003898845.1.87582 WP_003898845.1.87588 WP_003898845.1.87617 WP_003898845.1.87619 WP_003898845.1.87620 WP_003898845.1.87634 WP_003898845.1.87643 WP_003898845.1.8765 WP_003898845.1.87650 WP_003898845.1.87654 WP_003898845.1.87658 WP_003898845.1.87665 WP_003898845.1.87676 WP_003898845.1.87677 WP_003898845.1.87684 WP_003898845.1.87692 WP_003898845.1.87707 WP_003898845.1.87732 WP_003898845.1.87784 WP_003898845.1.87796 WP_003898845.1.87809 WP_003898845.1.87817 WP_003898845.1.87827 WP_003898845.1.87831 WP_003898845.1.87835 WP_003898845.1.87837 WP_003898845.1.87866 WP_003898845.1.8789 WP_003898845.1.87911 WP_003898845.1.87924 WP_003898845.1.87951 WP_003898845.1.87956 WP_003898845.1.87991 WP_003898845.1.88 WP_003898845.1.88002 WP_003898845.1.88037 WP_003898845.1.88039 WP_003898845.1.88072 WP_003898845.1.88077 WP_003898845.1.88121 WP_003898845.1.88191 WP_003898845.1.88205 WP_003898845.1.88217 WP_003898845.1.88219 WP_003898845.1.88245 WP_003898845.1.88253 WP_003898845.1.88294 WP_003898845.1.88315 WP_003898845.1.88316 WP_003898845.1.88320 WP_003898845.1.88338 WP_003898845.1.8840 WP_003898845.1.88437 WP_003898845.1.88453 WP_003898845.1.88469 WP_003898845.1.88489 WP_003898845.1.88507 WP_003898845.1.88521 WP_003898845.1.88530 WP_003898845.1.88537 WP_003898845.1.88541 WP_003898845.1.88592 WP_003898845.1.88616 WP_003898845.1.88618 WP_003898845.1.8862 WP_003898845.1.88625 WP_003898845.1.88632 WP_003898845.1.88634 WP_003898845.1.88649 WP_003898845.1.8870 WP_003898845.1.88737 WP_003898845.1.88756 WP_003898845.1.888 WP_003898845.1.88824 WP_003898845.1.88886 WP_003898845.1.88965 WP_003898845.1.88985 WP_003898845.1.8902 WP_003898845.1.89025 WP_003898845.1.89041 WP_003898845.1.89046 WP_003898845.1.89082 WP_003898845.1.89162 WP_003898845.1.89168 WP_003898845.1.8917 WP_003898845.1.89205 WP_003898845.1.89207 WP_003898845.1.89225 WP_003898845.1.8925 WP_003898845.1.89277 WP_003898845.1.89286 WP_003898845.1.89293 WP_003898845.1.89320 WP_003898845.1.8935 WP_003898845.1.89371 WP_003898845.1.89378 WP_003898845.1.89392 WP_003898845.1.89406 WP_003898845.1.89451 WP_003898845.1.89453 WP_003898845.1.89473 WP_003898845.1.89475 WP_003898845.1.89483 WP_003898845.1.895 WP_003898845.1.89513 WP_003898845.1.89517 WP_003898845.1.89522 WP_003898845.1.8954 WP_003898845.1.89543 WP_003898845.1.8957 WP_003898845.1.89572 WP_003898845.1.89589 WP_003898845.1.89607 WP_003898845.1.89613 WP_003898845.1.89625 WP_003898845.1.89648 WP_003898845.1.8967 WP_003898845.1.89670 WP_003898845.1.89676 WP_003898845.1.89729 WP_003898845.1.89739 WP_003898845.1.89762 WP_003898845.1.8977 WP_003898845.1.89808 WP_003898845.1.8982 WP_003898845.1.89829 WP_003898845.1.89831 WP_003898845.1.89844 WP_003898845.1.89849 WP_003898845.1.8989 WP_003898845.1.89901 WP_003898845.1.89903 WP_003898845.1.89909 WP_003898845.1.89922 WP_003898845.1.89926 WP_003898845.1.89963 WP_003898845.1.89971 WP_003898845.1.8998 WP_003898845.1.89987 WP_003898845.1.900 WP_003898845.1.90048 WP_003898845.1.9007 WP_003898845.1.90080 WP_003898845.1.90130 WP_003898845.1.90134 WP_003898845.1.90137 WP_003898845.1.90157 WP_003898845.1.90184 WP_003898845.1.90199 WP_003898845.1.90231 WP_003898845.1.90245 WP_003898845.1.90308 WP_003898845.1.90322 WP_003898845.1.90328 WP_003898845.1.90372 WP_003898845.1.90481 WP_003898845.1.90499 WP_003898845.1.9050 WP_003898845.1.90527 WP_003898845.1.90550 WP_003898845.1.90560 WP_003898845.1.90612 WP_003898845.1.90640 WP_003898845.1.90672 WP_003898845.1.90687 WP_003898845.1.90691 WP_003898845.1.90711 WP_003898845.1.90722 WP_003898845.1.90744 WP_003898845.1.9075 WP_003898845.1.90756 WP_003898845.1.90767 WP_003898845.1.90771 WP_003898845.1.90785 WP_003898845.1.90788 WP_003898845.1.90800 WP_003898845.1.90810 WP_003898845.1.90816 WP_003898845.1.90819 WP_003898845.1.9082 WP_003898845.1.90831 WP_003898845.1.90884 WP_003898845.1.90899 WP_003898845.1.90906 WP_003898845.1.90958 WP_003898845.1.90976 WP_003898845.1.90977 WP_003898845.1.90987 WP_003898845.1.9102 WP_003898845.1.91026 WP_003898845.1.91032 WP_003898845.1.91053 WP_003898845.1.91082 WP_003898845.1.91106 WP_003898845.1.91112 WP_003898845.1.91144 WP_003898845.1.91151 WP_003898845.1.91157 WP_003898845.1.91167 WP_003898845.1.91169 WP_003898845.1.91192 WP_003898845.1.91201 WP_003898845.1.91207 WP_003898845.1.91208 WP_003898845.1.91211 WP_003898845.1.91214 WP_003898845.1.91230 WP_003898845.1.91244 WP_003898845.1.91251 WP_003898845.1.91260 WP_003898845.1.91265 WP_003898845.1.91284 WP_003898845.1.91294 WP_003898845.1.91303 WP_003898845.1.91322 WP_003898845.1.91386 WP_003898845.1.9139 WP_003898845.1.91398 WP_003898845.1.91430 WP_003898845.1.91436 WP_003898845.1.91483 WP_003898845.1.91496 WP_003898845.1.91507 WP_003898845.1.91576 WP_003898845.1.91589 WP_003898845.1.91694 WP_003898845.1.91695 WP_003898845.1.91716 WP_003898845.1.91717 WP_003898845.1.91728 WP_003898845.1.91743 WP_003898845.1.91759 WP_003898845.1.91784 WP_003898845.1.91785 WP_003898845.1.91786 WP_003898845.1.91802 WP_003898845.1.91822 WP_003898845.1.91828 WP_003898845.1.9189 WP_003898845.1.91896 WP_003898845.1.9190 WP_003898845.1.91915 WP_003898845.1.91931 WP_003898845.1.91937 WP_003898845.1.91944 WP_003898845.1.91953 WP_003898845.1.91957 WP_003898845.1.91976 WP_003898845.1.92083 WP_003898845.1.92127 WP_003898845.1.92144 WP_003898845.1.92150 WP_003898845.1.92153 WP_003898845.1.92190 WP_003898845.1.92192 WP_003898845.1.92200 WP_003898845.1.92220 WP_003898845.1.92221 WP_003898845.1.92222 WP_003898845.1.92273 WP_003898845.1.92289 WP_003898845.1.9229 WP_003898845.1.92294 WP_003898845.1.92300 WP_003898845.1.92317 WP_003898845.1.92334 WP_003898845.1.92338 WP_003898845.1.92345 WP_003898845.1.92356 WP_003898845.1.92364 WP_003898845.1.92380 WP_003898845.1.92447 WP_003898845.1.92456 WP_003898845.1.92467 WP_003898845.1.92471 WP_003898845.1.92490 WP_003898845.1.92508 WP_003898845.1.9251 WP_003898845.1.92511 WP_003898845.1.92523 WP_003898845.1.92527 WP_003898845.1.92536 WP_003898845.1.92592 WP_003898845.1.92597 WP_003898845.1.92603 WP_003898845.1.92606 WP_003898845.1.92610 WP_003898845.1.92613 WP_003898845.1.9263 WP_003898845.1.9265 WP_003898845.1.92650 WP_003898845.1.92660 WP_003898845.1.92677 WP_003898845.1.92685 WP_003898845.1.92689 WP_003898845.1.92690 WP_003898845.1.92714 WP_003898845.1.92736 WP_003898845.1.9274 WP_003898845.1.92752 WP_003898845.1.92760 WP_003898845.1.92777 WP_003898845.1.92803 WP_003898845.1.92833 WP_003898845.1.92856 WP_003898845.1.92881 WP_003898845.1.92892 WP_003898845.1.92907 WP_003898845.1.92908 WP_003898845.1.9291 WP_003898845.1.92917 WP_003898845.1.92996 WP_003898845.1.93006 WP_003898845.1.93009 WP_003898845.1.93015 WP_003898845.1.93043 WP_003898845.1.9307 WP_003898845.1.93083 WP_003898845.1.93097 WP_003898845.1.93137 WP_003898845.1.93192 WP_003898845.1.93199 WP_003898845.1.93203 WP_003898845.1.93212 WP_003898845.1.93234 WP_003898845.1.93245 WP_003898845.1.93257 WP_003898845.1.93265 WP_003898845.1.93297 WP_003898845.1.93320 WP_003898845.1.93328 WP_003898845.1.93337 WP_003898845.1.93343 WP_003898845.1.93349 WP_003898845.1.93363 WP_003898845.1.93377 WP_003898845.1.9338 WP_003898845.1.93407 WP_003898845.1.93417 WP_003898845.1.93419 WP_003898845.1.93426 WP_003898845.1.9344 WP_003898845.1.93443 WP_003898845.1.93447 WP_003898845.1.93470 WP_003898845.1.93483 WP_003898845.1.93487 WP_003898845.1.93495 WP_003898845.1.93499 WP_003898845.1.93516 WP_003898845.1.93536 WP_003898845.1.93544 WP_003898845.1.93555 WP_003898845.1.93560 WP_003898845.1.93564 WP_003898845.1.9357 WP_003898845.1.93573 WP_003898845.1.93576 WP_003898845.1.93588 WP_003898845.1.9363 WP_003898845.1.93645 WP_003898845.1.93649 WP_003898845.1.93659 WP_003898845.1.93677 WP_003898845.1.9368 WP_003898845.1.93689 WP_003898845.1.93693 WP_003898845.1.93698 WP_003898845.1.93706 WP_003898845.1.9371 WP_003898845.1.93792 WP_003898845.1.93823 WP_003898845.1.93871 WP_003898845.1.9388 WP_003898845.1.93894 WP_003898845.1.93903 WP_003898845.1.93907 WP_003898845.1.93913 WP_003898845.1.93946 WP_003898845.1.93950 WP_003898845.1.93953 WP_003898845.1.93954 WP_003898845.1.93988 WP_003898845.1.9407 WP_003898845.1.94143 WP_003898845.1.94154 WP_003898845.1.94204 WP_003898845.1.94205 WP_003898845.1.94226 WP_003898845.1.94231 WP_003898845.1.94256 WP_003898845.1.94261 WP_003898845.1.94281 WP_003898845.1.94292 WP_003898845.1.94297 WP_003898845.1.9431 WP_003898845.1.94326 WP_003898845.1.94339 WP_003898845.1.94392 WP_003898845.1.94416 WP_003898845.1.94421 WP_003898845.1.94456 WP_003898845.1.94480 WP_003898845.1.94495 WP_003898845.1.94511 WP_003898845.1.94512 WP_003898845.1.94528 WP_003898845.1.94564 WP_003898845.1.946 WP_003898845.1.94623 WP_003898845.1.94629 WP_003898845.1.9465 WP_003898845.1.94673 WP_003898845.1.94714 WP_003898845.1.94730 WP_003898845.1.94736 WP_003898845.1.94776 WP_003898845.1.9478 WP_003898845.1.94834 WP_003898845.1.94852 WP_003898845.1.94872 WP_003898845.1.9488 WP_003898845.1.94902 WP_003898845.1.94916 WP_003898845.1.94979 WP_003898845.1.94994 WP_003898845.1.94996 WP_003898845.1.94998 WP_003898845.1.95007 WP_003898845.1.95010 WP_003898845.1.95015 WP_003898845.1.95034 WP_003898845.1.95068 WP_003898845.1.95081 WP_003898845.1.95082 WP_003898845.1.9509 WP_003898845.1.95096 WP_003898845.1.95112 WP_003898845.1.95138 WP_003898845.1.9514 WP_003898845.1.95179 WP_003898845.1.95188 WP_003898845.1.95190 WP_003898845.1.95234 WP_003898845.1.95241 WP_003898845.1.95245 WP_003898845.1.95257 WP_003898845.1.95279 WP_003898845.1.9531 WP_003898845.1.95335 WP_003898845.1.95344 WP_003898845.1.9535 WP_003898845.1.95370 WP_003898845.1.95392 WP_003898845.1.95416 WP_003898845.1.95417 WP_003898845.1.95454 WP_003898845.1.95455 WP_003898845.1.95491 WP_003898845.1.95497 WP_003898845.1.95508 WP_003898845.1.95509 WP_003898845.1.95529 WP_003898845.1.95556 WP_003898845.1.95557 WP_003898845.1.95565 WP_003898845.1.95578 WP_003898845.1.95580 WP_003898845.1.95585 WP_003898845.1.95643 WP_003898845.1.95679 WP_003898845.1.95685 WP_003898845.1.957 WP_003898845.1.95724 WP_003898845.1.95727 WP_003898845.1.95730 WP_003898845.1.95758 WP_003898845.1.95772 WP_003898845.1.95797 WP_003898845.1.95839 WP_003898845.1.9585 WP_003898845.1.9590 WP_003898845.1.95902 WP_003898845.1.95924 WP_003898845.1.95926 WP_003898845.1.95953 WP_003898845.1.95958 WP_003898845.1.95964 WP_003898845.1.95973 WP_003898845.1.96006 WP_003898845.1.9602 WP_003898845.1.96036 WP_003898845.1.96062 WP_003898845.1.96065 WP_003898845.1.96098 WP_003898845.1.96146 WP_003898845.1.96166 WP_003898845.1.96171 WP_003898845.1.96182 WP_003898845.1.96230 WP_003898845.1.96235 WP_003898845.1.96242 WP_003898845.1.96245 WP_003898845.1.96254 WP_003898845.1.96259 WP_003898845.1.96286 WP_003898845.1.96313 WP_003898845.1.96318 WP_003898845.1.96345 WP_003898845.1.96360 WP_003898845.1.96373 WP_003898845.1.96456 WP_003898845.1.96486 WP_003898845.1.96560 WP_003898845.1.96569 WP_003898845.1.96573 WP_003898845.1.96576 WP_003898845.1.96611 WP_003898845.1.96621 WP_003898845.1.9667 WP_003898845.1.96681 WP_003898845.1.96726 WP_003898845.1.96733 WP_003898845.1.96742 WP_003898845.1.96754 WP_003898845.1.9678 WP_003898845.1.96832 WP_003898845.1.9685 WP_003898845.1.97008 WP_003898845.1.97009 WP_003898845.1.97056 WP_003898845.1.97084 WP_003898845.1.97087 WP_003898845.1.97094 WP_003898845.1.97096 WP_003898845.1.97099 WP_003898845.1.97108 WP_003898845.1.97113 WP_003898845.1.97122 WP_003898845.1.97129 WP_003898845.1.97136 WP_003898845.1.9716 WP_003898845.1.97176 WP_003898845.1.97222 WP_003898845.1.97237 WP_003898845.1.97242 WP_003898845.1.97270 WP_003898845.1.97283 WP_003898845.1.97296 WP_003898845.1.97321 WP_003898845.1.97325 WP_003898845.1.97366 WP_003898845.1.97376 WP_003898845.1.97380 WP_003898845.1.97462 WP_003898845.1.97517 WP_003898845.1.97519 WP_003898845.1.97535 WP_003898845.1.97540 WP_003898845.1.97545 WP_003898845.1.97546 WP_003898845.1.97550 WP_003898845.1.97577 WP_003898845.1.97584 WP_003898845.1.9759 WP_003898845.1.97591 WP_003898845.1.97618 WP_003898845.1.9763 WP_003898845.1.97669 WP_003898845.1.97673 WP_003898845.1.97700 WP_003898845.1.97701 WP_003898845.1.9773 WP_003898845.1.97730 WP_003898845.1.97740 WP_003898845.1.97751 WP_003898845.1.97754 WP_003898845.1.97797 WP_003898845.1.9782 WP_003898845.1.9784 WP_003898845.1.97888 WP_003898845.1.9790 WP_003898845.1.9795 WP_003898845.1.97951 WP_003898845.1.97958 WP_003898845.1.97966 WP_003898845.1.97977 WP_003898845.1.97979 WP_003898845.1.97995 WP_003898845.1.98018 WP_003898845.1.98034 WP_003898845.1.98052 WP_003898845.1.98071 WP_003898845.1.98072 WP_003898845.1.98113 WP_003898845.1.98114 WP_003898845.1.98128 WP_003898845.1.98188 WP_003898845.1.98189 WP_003898845.1.98213 WP_003898845.1.98225 WP_003898845.1.98291 WP_003898845.1.98335 WP_003898845.1.98350 WP_003898845.1.98395 WP_003898845.1.98412 WP_003898845.1.98441 WP_003898845.1.98443 WP_003898845.1.98462 WP_003898845.1.9848 WP_003898845.1.98482 WP_003898845.1.98486 WP_003898845.1.98488 WP_003898845.1.98503 WP_003898845.1.98516 WP_003898845.1.98536 WP_003898845.1.98541 WP_003898845.1.98566 WP_003898845.1.98576 WP_003898845.1.98590 WP_003898845.1.98594 WP_003898845.1.98599 WP_003898845.1.98629 WP_003898845.1.98645 WP_003898845.1.98646 WP_003898845.1.98649 WP_003898845.1.98656 WP_003898845.1.9867 WP_003898845.1.98674 WP_003898845.1.98697 WP_003898845.1.98701 WP_003898845.1.98739 WP_003898845.1.98749 WP_003898845.1.98765 WP_003898845.1.98770 WP_003898845.1.98777 WP_003898845.1.98778 WP_003898845.1.98802 WP_003898845.1.98838 WP_003898845.1.98906 WP_003898845.1.98935 WP_003898845.1.98948 WP_003898845.1.98953 WP_003898845.1.98984 WP_003898845.1.99000 WP_003898845.1.99023 WP_003898845.1.99030 WP_003898845.1.99055 WP_003898845.1.99062 WP_003898845.1.99086 WP_003898845.1.99115 WP_003898845.1.99161 WP_003898845.1.99176 WP_003898845.1.99211 WP_003898845.1.99216 WP_003898845.1.99222 WP_003898845.1.99251 WP_003898845.1.99294 WP_003898845.1.99312 WP_003898845.1.99315 WP_003898845.1.99316 WP_003898845.1.99322 WP_003898845.1.99328 WP_003898845.1.99365 WP_003898845.1.99368 WP_003898845.1.99396 WP_003898845.1.99402 WP_003898845.1.99404 WP_003898845.1.99419 WP_003898845.1.99438 WP_003898845.1.99460 WP_003898845.1.99468 WP_003898845.1.99473 WP_003898845.1.99513 WP_003898845.1.99529 WP_003898845.1.99548 WP_003898845.1.99572 WP_003898845.1.99575 WP_003898845.1.99578 WP_003898845.1.99605 WP_003898845.1.99609 WP_003898845.1.99617 WP_003898845.1.99635 WP_003898845.1.99650 WP_003898845.1.99672 WP_003898845.1.99701 WP_003898845.1.99711 WP_003898845.1.99716 WP_003898845.1.99740 WP_003898845.1.99745 WP_003898845.1.99749 WP_003898845.1.9976 WP_003898845.1.99798 WP_003898845.1.99817 WP_003898845.1.99847 WP_003898845.1.99852 WP_003898845.1.99886 WP_003898845.1.99897 WP_003898845.1.99899 WP_003898845.1.99915 WP_003898845.1.9993 WP_003898845.1.99991 gi|494695775|ref|YP_007961278.1| gi|471337287|ref|YP_007610000.1| gi|253799585|ref|YP_003032586.1| gi|479055329|ref|YP_007351135.1| gi|15608505|ref|NP_215881.1| gi|385998151|ref|YP_005916449.1| gi|494691942|ref|YP_007957485.1| gi|479314273|ref|YP_007854325.1| gi|375296827|ref|YP_005101094.1| gi|148822587|ref|YP_001287341.1| gi|340626381|ref|YP_004744833.1| gi|433634429|ref|YP_007268056.1| gi|506925838|ref|YP_008006288.1| gi|433626467|ref|YP_007260096.1| gi|383307235|ref|YP_005360046.1| gi|392433037|ref|YP_006474081.1| gi|506925838|ref|YP_008006288.1| gi|148661155|ref|YP_001282678.1| gi|197740074|ref|YP_002161388.1| gi|15608505|ref|NP_215881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]