SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGRC-90652857 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-90652857
Domain Number 1 Region: 10-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-44
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 202-334
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-90652857
Sequence length 335
Comment $ NYSGXRC $ SQ243423 $ PDBT197148 $
Sequence
MELSCPGSRCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILKAKGTLRP
PERQALFGSWELIYGASQELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQ
LKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVALAENTGPNSPDHQQL
TRAARLISETAQRVHTIGQKQKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPH
GEPRPRMFFLFTDVLLMAKPRPPLHLLRSGTFACKALYPMAQCHLSRVFGHSGGPCGGLL
SLSFPHEKLLLMSTDQEELSRWYHSLTWAISSQKN
Download sequence
Identical sequences Q8N4T4
gi|90652857|ref|NP_116207.2| ENSP00000367638 ENSP00000367638 9606.ENSP00000367638 ENSP00000344922 NP_116207.2.87134 NP_116207.2.92137 NYSGRC-90652857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]