SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGRC-FDAO-AAU27508 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-FDAO-AAU27508
Domain Number 1 Region: 302-607
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-33
Family Lysophospholipase 0.023
Further Details:      
 
Weak hits

Sequence:  NYSGRC-FDAO-AAU27508
Domain Number - Region: 4-30,753-840
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0327
Family DBL homology domain (DH-domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-FDAO-AAU27508
Sequence length 884
Comment $ NYSGXRC $ SQ253302 $ PDBT194949 $
Sequence
MMTPQHVISQLLESDTKYPQNLDLLKKIIISAYLGRLRINGLPPDNKIALGNYLFDDERM
IFDFTRLSDSKRALFIEWLLEPHQKDKEHGFLSGVYVNEYRGFTAEVALSWWGILKNWLF
NNKSEHWKITDLGLSVNYQLTGIEMCHGKQGILIGFNQFLVPPSGTKYRDPNDSQSEPLG
NVKRVFITDKLVDELVGLNYKKLNYESVCKSPHPQSIDVTDPEARHKDMYDYRKMQRFNG
VRPWYIRLWRWISKLFFGDTYDAKKTSTSDDNLELLYKTKTVKIYQRSKSKEILVTEKRP
DITNLVFCGGGAKIFAHVGVWKALNEAGMKPTKFAGSSAGAIMSLMCYLGYTADEISELF
KHFKQEHLVQFDIDRNGLSDTHSLKTALDYAIANKVRQIVNKYKIPYPKGKITFSTLASL
REQFPDCGIGKELIVTATNKRSGKTIYLSANRYPLLEVSEAVKISASFPVLYRDTLLDGE
EHNDGGILSNFPTEVFFDDHSTLLESEFGNNLKVLAVQFDNGIERNVIDRIMDKVYRENF
VLNWIYSLLTGVSDPASGWERDRLKLRQYALQTIIPETGKVSTTGFNVERQSQEELIQNG
YQSTLDYLNVRYTRKNNSYVNKEIMYSTFNSLGDLLAYCCYRGDEQWFNVVNNLIVQSTL
PNRTALMKQSLELRKLYFNTSLPSNPEKNKTACNESNTLTFFGNAVCQHHNHSQELENGN
HDVLLALYPIFLKLSTDLLINKIDKNLLDRARHSLNIHSPFDCLEHFNKISGNAHVMIHI
IVKLIKELKERSCQQIYDVLKEVRHLLYSDINLMKANYFGKWDLGLPQCIRILNLLKQEK
HDDVSRLLDCLRNQMEPVQTVKGGVHHDDLNNGSHERYRFGLGV
Download sequence
Identical sequences A0A2J9NJE6 G8UWI8 Q5ZVL4
gi|378777291|ref|YP_005185728.1| 272624.lpg1426 gi|52841656|ref|YP_095455.1| WP_010947155.1.100881 WP_010947155.1.101385 WP_010947155.1.10160 WP_010947155.1.11666 WP_010947155.1.1188 WP_010947155.1.12035 WP_010947155.1.12661 WP_010947155.1.14235 WP_010947155.1.15016 WP_010947155.1.16078 WP_010947155.1.16593 WP_010947155.1.16748 WP_010947155.1.16962 WP_010947155.1.17857 WP_010947155.1.19321 WP_010947155.1.19554 WP_010947155.1.20369 WP_010947155.1.2062 WP_010947155.1.2085 WP_010947155.1.21466 WP_010947155.1.21493 WP_010947155.1.21924 WP_010947155.1.22734 WP_010947155.1.2333 WP_010947155.1.23459 WP_010947155.1.24053 WP_010947155.1.24333 WP_010947155.1.2441 WP_010947155.1.24636 WP_010947155.1.26718 WP_010947155.1.27038 WP_010947155.1.27501 WP_010947155.1.27674 WP_010947155.1.28814 WP_010947155.1.29318 WP_010947155.1.29802 WP_010947155.1.30583 WP_010947155.1.30653 WP_010947155.1.30822 WP_010947155.1.31291 WP_010947155.1.32608 WP_010947155.1.32615 WP_010947155.1.33479 WP_010947155.1.33708 WP_010947155.1.35118 WP_010947155.1.35787 WP_010947155.1.36420 WP_010947155.1.37108 WP_010947155.1.37274 WP_010947155.1.37932 WP_010947155.1.3819 WP_010947155.1.38679 WP_010947155.1.40870 WP_010947155.1.41185 WP_010947155.1.41378 WP_010947155.1.41486 WP_010947155.1.44619 WP_010947155.1.44866 WP_010947155.1.45024 WP_010947155.1.46042 WP_010947155.1.46096 WP_010947155.1.47823 WP_010947155.1.47956 WP_010947155.1.48346 WP_010947155.1.51153 WP_010947155.1.51428 WP_010947155.1.51956 WP_010947155.1.52283 WP_010947155.1.52706 WP_010947155.1.52905 WP_010947155.1.53250 WP_010947155.1.53261 WP_010947155.1.53669 WP_010947155.1.53795 WP_010947155.1.53844 WP_010947155.1.54355 WP_010947155.1.57055 WP_010947155.1.57468 WP_010947155.1.58541 WP_010947155.1.58606 WP_010947155.1.58931 WP_010947155.1.59227 WP_010947155.1.59576 WP_010947155.1.60239 WP_010947155.1.60770 WP_010947155.1.61895 WP_010947155.1.62077 WP_010947155.1.63282 WP_010947155.1.636 WP_010947155.1.64335 WP_010947155.1.64388 WP_010947155.1.64512 WP_010947155.1.64856 WP_010947155.1.66209 WP_010947155.1.66299 WP_010947155.1.68412 WP_010947155.1.68702 WP_010947155.1.69197 WP_010947155.1.70346 WP_010947155.1.70691 WP_010947155.1.7124 WP_010947155.1.71556 WP_010947155.1.73029 WP_010947155.1.73915 WP_010947155.1.74438 WP_010947155.1.75353 WP_010947155.1.75911 WP_010947155.1.76298 WP_010947155.1.76893 WP_010947155.1.77472 WP_010947155.1.77852 WP_010947155.1.77866 WP_010947155.1.79027 WP_010947155.1.79030 WP_010947155.1.79957 WP_010947155.1.80678 WP_010947155.1.80733 WP_010947155.1.80817 WP_010947155.1.81970 WP_010947155.1.82765 WP_010947155.1.83499 WP_010947155.1.8363 WP_010947155.1.84081 WP_010947155.1.85699 WP_010947155.1.86349 WP_010947155.1.86607 WP_010947155.1.87629 WP_010947155.1.87656 WP_010947155.1.88081 WP_010947155.1.89135 WP_010947155.1.89155 WP_010947155.1.89171 WP_010947155.1.90392 WP_010947155.1.90650 WP_010947155.1.91256 WP_010947155.1.91480 WP_010947155.1.93200 WP_010947155.1.94508 WP_010947155.1.9567 WP_010947155.1.96018 WP_010947155.1.96198 WP_010947155.1.97528 WP_010947155.1.97598 WP_010947155.1.97635 WP_010947155.1.98470 WP_010947155.1.98928 YP_095455.1.86292 NYSGRC-FDAO-AAU27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]