SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-11009v from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-11009v
Domain Number 1 Region: 9-277
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-61
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Domain Number 2 Region: 322-432
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-19
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-11009v
Sequence length 439
Comment $ NYSGXRC $ SQ139071 $ PDBT176539 $
Sequence
VTSGTRSTITLGCVLNDPRFTFWSILRHGIRSRAADHGIAVIDQAAGAVEAQVEMVADLL
RRRVHALILGPAHETRAFAQHLELARLARVPVIEVDGGILEGYVSATVRSNERQGLMRVA
ELLVAHLGDRMRIALIAGPRNRRAEIMAEVLRQWPGVQIVAQSTGDWTRDSGRRLAEEWL
RTGQPIDAIFAANDPMALGVVDAVEALNLTGSIAVVGFDGLPEALRAINSGAMLATVNQD
PLCIGQQAVDTALQALRSEPVERQILTPGELITRDTVTESALRALDLLPGIMRDLIESNA
ERQRLQEEIIAAQRSTIQELSTPIIPIDARTLIVPLIGAIDSTRAAQMTQTILEAIGDQR
ADDVIIDITGIAVVDTSVANHLVQTAQAASLLGAHVTLAGMSPEVAQTIVQLGIKLGQLT
TCSNLQTALEVVQRRRGRR
Download sequence
Identical sequences NYSGXRC-11009v

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]