SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-11010n from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-11010n
Domain Number 1 Region: 6-268
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.14e-51
Family L-arabinose binding protein-like 0.00016
Further Details:      
 
Domain Number 2 Region: 579-685
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000177
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-11010n
Sequence length 689
Comment $ NYSGXRC $ SQ139028 $ PDBT176557 $
Sequence
MASRQAIGFIAPSLAGEFMTGVMEGILQSLRKHQYDLIAVQGAPQHLINNQLAKQHIKAW
IVIIDPTGLNELATNMPAVVISAPNAGERFPLVMPDNNQSARAMVEHLIEHGHSKIAFVG
NFNNSDMRDRYTVYCDVLNEHSITPNPAWVVDVGDYTEGRTEHAFYPLIANGLNFSAVVA
ANDQQAVGVMMALETKGYRVPHDMAVVGFDDATIAQHANPPLTTVRQQPQLLGSIAADTV
IELIAGKPVSNAPIYVPTIPIWRQSCGCKDVYTGIKTSTVAPKQQHWADQLAQRMQQVIY
YPVPIDPNLSLNESNQGIRSLIQALQAKVEAQNVEVDYLAAWYAIITVSSKSDTLSVLYQ
VFATAANQQLAQIDLPADQINGFLATAHTSLLHTVLELQRNEITGLDRLLAANHELSMLL
VSNQKQQTGKLAWMQRLPVSIACLALWDEQKPGFLRLASIYSKDGSSTIKAGSHCHGSEF
PPAEFLEQARQLNSSGYVACVPIVTASHDWGILAFGHADVQKTIADINSLYIWASILGSS
LEHEALESTLDAEREVLRGAVDREHALSKTILELGCPLIPLLPGVLLIPLIGSINTERAQ
QITETVLNGINEQQASRVLLDITGVSMVDTHVASSLMQIARAAMLLGAKVALVGVRPDIA
QSIVSLGINLNTLVTYPNLRTAIQQMAMV
Download sequence
Identical sequences A9AUL9
NYSGXRC-11010n gi|159898427|ref|YP_001544674.1| 316274.Haur_1903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]