SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-T146 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-T146
Domain Number 1 Region: 53-241
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-43
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 238-359
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000081
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-T146
Sequence length 665
Comment $ NYSGXRC $ SQ38562 $ PDBT198956 $
Sequence
MNAGKEFNYYTYQSDSSQGSLQKAPDENTDYFTHKMNSYLPFDMSTLYANQPTEKIQILQ
EIYDTERTYVKALTIVDEIFIQQLNLWCPKSKKCFRSMFGEISAICKTHQILLESLQCKP
IAEVFTKFVPFLKLYTSYASHYPNSLKIFAKLMSRNDFRKALTKIEEDPRVDGKKLQTYL
IMPIQRIPRYIMLIQNLMNYSTEKDDMTNLYKALSGMQGLSDQIQSCMTAYENGERLLQI
QLNFGLDGHILEPGRVLLKEGMLYKRELNGSANYQETVVFLFNDILLYGIKRISVMPLCK
YEPSAILSLRHCIVQLDDIGGSIFIRCGDVGVDFTAYSLGGVTEWYNEICDAIDNAKKLR
DTLRKESFKQKSLIFDKGFWQRNRDKLRNMITADMTGNISRVLTRKKPAPKLEESDFLRG
QWTTSTIASNQRKRKVATLEDEEEDVFNMLSSPNLSQRKRKATLQENTPSGVGWTASPRS
SSFRKRRASTLRNKNADVTDGNNYLSHLVLNDVTMTQPYTGLNAFVGTPKSRTPTDDDYD
SDRDYVWTDDEEFVSDDKKIPIRRVASYDEEDRRPRDFSEVRRSVASEPPRRHLAVDDIR
KLSYQQRSLEPFNMVTEDDDEDDIIDIKVKGERPRPWWETESAPPAIKNQKSSIIDSIRN
SCAIM
Download sequence
Identical sequences Q11100
C02F12.4 NYSGXRC-T146 NYSGXRC-T403 C02F12.4 C02F12.4 6239.C02F12.4 NP_508633.1.50509 C02F12.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]