SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NpR67A from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NpR67A
Domain Number - Region: 8-55
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0373
Family Sfri0576-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NpR67A
Sequence length 103
Comment $ NESG $ SQ212682 $ PDBT165067 $
Sequence
MKRANTFAMRPLTADDEQVLRDLLDASAALWNEINYQRLMRYNDKDGFEDEDVWDADTGA
LEGKYKAVLGASTAQTVRRANTEAWRSFFRLKKQFHDESNTSV
Download sequence
Identical sequences NpR67A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]