SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pfal001075AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pfal001075AAA
Domain Number 1 Region: 24-91
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000484
Family Chaperone J-domain 0.0017
Further Details:      
 
Domain Number 2 Region: 136-219
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000157
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pfal001075AAA
Sequence length 366
Comment $ SGPP $ SQ58784 $ PDBT216185 $
Sequence
MGSSHHHHHHGGTGENLYFQGGSGNNIDKSYFKLAKEHYPINGSTIDDLKKFKEINEAYQ
VLGDIDNKRKYNQYGYNGIKNFNFIYPSLFYFFSCLKKYDYYTGTPHITSILKFLFEKKL
TMDDIETKSQYILRVMNEYQKEIEATISLRLIDKIQGNIDGIKSWDARIISEIKKLESHF
SLPILDSMAHIFINVSQCYIGNQEKAKKKIQNRFKKNKLKSSCAYNELRYTLREYFKTRK
QVSSLSYTLENNNNKKYNQNKWYKNITNLDDKNKYKILYSFVKNLIKIALSDIEYTIKTV
CENILTEKGIDDITIKARAESLNKLGYIIRQNILKGKNIKKIIKCDSRNIAANIVREINT
INELLK
Download sequence
Identical sequences Pfal001075AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]