SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pfal004284AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Pfal004284AAA
Domain Number - Region: 144-242
Classification Level Classification E-value
Superfamily THUMP domain-like 0.0576
Family THUMP domain 0.048
Further Details:      
 
Domain Number - Region: 93-168
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0916
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pfal004284AAA
Sequence length 253
Comment $ SGPP $ SQ60062 $ PDBT217756 $
Sequence
MAHHHHHHMKMKIPICFLIILVLLKCVLSYNLNNDLSKNNNFSLNTYVRKDDVEDDSKNE
IVDNIQKMVDDFSDDIGFVKTSMREVLLDTEASLEEVSDHVVQNISKYSLTIEEKLNLFD
GLLEEFIENNKGLISNLSKRQQKLKGDKIKKVCDLILKKLKKLENVNKLIKYKIILKYGN
KDNKKEMIQTLKNEEGLSDDFKNNLSNYETEQNNDDIKEIELVNFISTNYDKFVVNLEDL
NKELLKDLNMALS
Download sequence
Identical sequences Pfal004284AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]