SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pfal006105AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pfal006105AAA
Domain Number 1 Region: 830-881
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000134
Family UBA domain 0.011
Further Details:      
 
Domain Number 2 Region: 173-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000845
Family Ubiquitin-related 0.016
Further Details:      
 
Weak hits

Sequence:  Pfal006105AAA
Domain Number - Region: 298-389
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0654
Family DBL homology domain (DH-domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pfal006105AAA
Sequence length 890
Comment $ SGPP $ SQ70167 $ PDBT228257 $
Sequence
MAHHHHHHMANSMEKNEKEKVDVHTNNIDLNEYKYVINNSHSSDEGEEDVSSYDENDNEE
YTNDELIKEDDSNNKRNKVLDTNKYRNNDIINHNINGRNGLINNNEDIKDISEGTMNKED
SLICDKDKEENVEILNNKKNEKYNNNNNNNCNMFNKDDNICVKKNREGYELNHKNKNIVD
NKYIYVRLKTNDCNNNIYKCRIEKNISVKKMKKGLNKILNNNNDMNYRIIYRGRSLKDID
EIAKYNIKFNDIIYAIKVHKKKNGNDVTLDSGITSSQLSTLNDEYNEYGKYGQNDGISKL
ISNMFDNSDFIKSIMDSNKQLKKLREQNSDLNHILNDSQTLKQSFEMIKNPSLMKELMKN
TDRAISNIEAIPGGFNTLRRMYHNIQEPMYESTEKLIEKKLNKVKHYDLNSTSPPTSQAF
PNPWASKNTKNKNSINNKNNYNLNNFEKFFQTNEKTQNFKSNLSTDNNNNNNNNNNNNNN
NNNNNNNNNNNHTNSLLNNQNKLFFDKNKRGSNNTSTNNNTTHNIMNNNNLNDLMNNSFL
SNSLFPLLNKLQLPQTNKNVSNNKNVINGNNDYQNNLTDEYKNSTQHVHNLAHTNKNQND
TLSTNRLTNNNKDNKLDETIENSSNMLNNLLMSMNKNLNMNSTSPTNNTSSDLMNTINMI
NSLSNLGNYNTPYGNIVGENTTTNNSKNYAHNNNNKDNNIDSASGSIPPYYMDQSFFMEA
MNFLRNTTNNDIVNNNNNNNNSSSNNNRFNNALFNNTPLNNNFSNFMNVLQNVGAGNGYI
PSGRTNNTNENQAPRTIENEIKNVEEKQEGIQDTLKSTDILNIKNNDTNISNNINGEAND
HNIYSEQLNSLKGMGFTDVEKCLKALIKSKGNVEGAIDFLLLDESNVNES
Download sequence
Identical sequences Pfal006105AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]