SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pfu-1531828-001 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pfu-1531828-001
Domain Number 1 Region: 117-335
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.95e-31
Family Enolase 0.0063
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.55e-30
Family Enolase N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pfu-1531828-001
Sequence length 339
Comment $ SECSG $ SQ52789 $ PDBT16054 $
Sequence
MSIIQDIIGRIVVLRGGQYSVEVDVVTDESFGRFAAPIDENPALYIAEARRAVSEVDEII
GPELIGFDAIDQELIDSYLWEIDGTDNFSHIGANTALAVSVAVAKAAANSRNISLYSYIG
GTFTTELPVPVVTFGADENFEYHVIVRDLLEVTDIIDAVVRLLDFSLSLEELSKASEQVG
LELGLEVSLGITMRKELETEKVLEIVEDYNIAYIKPIGTPELFLELIAGTHGVFIDGEYL
YRKYNILDRKYYNALSIKPINLGTLTDLYNFVNDVKAEKITPILSESKYEPADETLPHLA
LGLRCPAMLIHMNSVEKINELNRIAEELGERGRIITFEE
Download sequence
Identical sequences I6TZM0 Q8U0E9
WP_011012788.1.13913 WP_011012788.1.59273 gi|397652710|ref|YP_006493291.1| 186497.PF1641 Pfu-1531828-001 gi|18978013|ref|NP_579370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]