SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SR321 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SR321
Domain Number 1 Region: 8-80
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SR321
Sequence length 94
Comment $ NESG $ SQ37949 $ PDBT127521 $
Sequence
MPVRCVERKITSLVVDLSGVPIVDTMVAQQLYNLSKTLFLLGVKAVFSGIRPDVAQTSIQ
LGLDFSEYETYGTLKQALENMGVRCIVEELEENK
Download sequence
Identical sequences A0A164UFM8 L8ADS1
SR321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]