SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T08H4.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T08H4.1
Domain Number 1 Region: 121-343
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-38
Family DBL homology domain (DH-domain) 0.00072
Further Details:      
 
Domain Number 2 Region: 376-481
Classification Level Classification E-value
Superfamily PH domain-like 1.87e-22
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T08H4.1
Sequence length 862
Comment $ SECSG $ SQ45966 $ PDBT8208 $
Sequence
MSAEAVSRKSSFVNSRILNRGSRNHPGLNGSDDAECRSNDSSLSVRDSWQYDEPSCSEVP
DDGGTRRARSVTSSRISLFFGKETGKIEKEMFRILNQKKEDTDLEYPTYKLEKDWREIVH
NHESLSDKSIKQQEAIWEIVTTEFRYIKLLRYLSNLSFYLTDLQNCGFLKDIENRLVFFN
FVTLFNVNYDSLWLQSIEPILAKSRETGEPLDVNYLQNGFRDIENWSRCYTNFHLAHSDS
LKHIQKKLKESENFRDFVTWAEAQENLDRQKLIDTFSVPMQRLTRYNLLLKAVLKVTTDE
NEREMISNLVDCAESATAQLNKELNNNDLRAMLGDVMRTIEGPDYVDQDELERLFNLKLP
LNLGDFMPLLHPRKPTHRTLIYRGDLRMQEGKKGSKADVHCIIFTDMFLICRKVQGKKDR
LKILKPPIHMGKMMFHYFADQNGFYLVHLTDFHTAQALYSMHTSGPEDTLRWTDMLKMAL
DEFKKIHRDSWSQQNQQESPLDEYGRGFIMEPSSFYSQRMLPPGYAQQQMPVIHRKCSSM
DSQAVAAHAHLNYMHRSSAVSSTEQLDRHSGTDSMKCSPPRHKLSVASCHANPLSSSKSS
VDLYVSLGAENGDIERPRSRSNSSGPEIEGLKQRSRSSSPDQKELGTPAQIGSPQTNTPC
RDSPTLLITSDDCVEPLQFGRRFEKRYHTADGIDVLKPKISKLPGAILKRFSLNGGSGAV
GSSCKKLESSKRNSQASNAASLDSFGSSTSGISTASSNNNDPSMETLTSKLSHISTISIN
DSPSSIDSQGTLSISLEAPPTVLEKDEDQHSIEVSVPPPPELPPPSKTPSPNLPTHKPNK
SKVHCEELMKFIQDNRLETSDV
Download sequence
Identical sequences Q22354
T08H4.1a T08H4.1 6239.T08H4.1 T08H4.1 T08H4.1 NP_494723.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]