SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T19E10.1A from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T19E10.1A
Domain Number 1 Region: 346-580
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-36
Family DBL homology domain (DH-domain) 0.00065
Further Details:      
 
Domain Number 2 Region: 208-294
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000233
Family DNA ligase 0.08
Further Details:      
 
Domain Number 3 Region: 112-189
Classification Level Classification E-value
Superfamily BRCT domain 0.000000145
Family DNA ligase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T19E10.1A
Sequence length 924
Comment $ SECSG $ SQ45697 $ PDBT8206 $
Sequence
MDVSMLQSPQKRIKTIQKLAVSKKDVHDFKDIFEMLEEQKEKRNINIIQYDSLDDLSGDW
SEYTFFCGNFDSDLFRTLTKHQETQALFIIGASVLKNKLLKNEDLMTLRAARPLYCELMK
DVTMKLAAEVPNKRELVDLVHYMGGSVRKDTVSRTNVFIAAKVEAKVQSISLVGVPTMRA
DWVTECWKHRDDSYFDVMEPCFVDKHRLGVFEGLSLFFHGFKQTEIDDMLRSLENTGGKL
APSPTLATHVVYNPDNDEVETLAVSSNQVHVTKEWFWVSLHRGCCAIEDNFALPTGKLHR
KPLESSSVSSPIGKSLRSQNSRSLSSMRDCSVEGPTSLNMTPDYIYSNDDVENSCKSPRQ
PSKRLRVCMEMVETEKNYLSLLKLVVKFKEALECEISHNEFMSRSDVAMMFGKLDPILEL
HERIFARLTVMSNEANTLLTVVNGKKNDDKNLDFAQVWIDAKEEMKKAYPQYINSYDTIK
RLFDKQDRENSKFHTFCKAKESNPEFHRLKLTDLMVKPVQRLPSVILLLKEMAKKSDSKL
KNNAEEAAKAIDEVLKTANKTREKNDNFISHLSKFTDIENVPPILVAANRMFIRELVVSP
IASTSPGLQQFAKMKLFLFHDVLIITKIRSEKNTMQRLARHASFASLHSRQRRPYRYIDQ
IQLNTMRSAFRIRAPDEIAKCLELQQQNGSTKPNVFVWCLIHRDEQGGDIDTVFESNDDE
EVRDFLDDIHVKILSDCGRFFYSSDPSDMNEINDAMVSDMTTRYFRNLCGAKPQYGHGSQ
MNITEWSHNESFMPPPQSQSRMRRAFSNAQLTLATTLGFGRNQSRNNLGQINENTTFLQS
PRVSCDPAALANMTSVGGLPGCQSESESTPKRGIRSRLTSTTFLGGRHNILGRNTSMRRQ
ATGFAHSEKELPRSKTSSYRVTDI
Download sequence
Identical sequences Q22590
T19E10.1a T19E10.1a T19E10.1A NP_496319.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]