SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XaR52 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XaR52
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000000000224
Family Tpt1/KptA 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XaR52
Sequence length 59
Comment $ NESG $ SQ35639 $ PDBT124792 $
Sequence
MCICPNRQTAASVGQRYGEPVVLRVDAGRMHRNGLPFFKADNGVWLTAQVPAAFLTRPR
Download sequence
Identical sequences A0A0U5FLP8 A0A1T1RUZ1 M4TZZ5
190486.XAC4309 gi|21245021|ref|NP_644603.1| XaR52 gi|471270169|ref|YP_007652634.1| gi|470474114|ref|YP_007638682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]