SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Y95B8A.12 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y95B8A.12
Domain Number 1 Region: 174-399
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-41
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 412-556
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-24
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Y95B8A.12
Sequence length 621
Comment $ SECSG $ SQ52092 $ PDBT2376 $
Sequence
MVDLQLFTPLIRYSEPEEGEPQTIHPNKEQLSRRHAIIPDQPSENQETSSQGCCSSDNVI
IVPHVQISPNESHLFNRAISSGGGLLADSNKITSIDLQRATIASQAFYAEASEPQKNRSP
WILKRLYEWSGRAKRREIIKHVQAALETSKDHEIEDDELEKLLPVSFEEMFMGDETTTIP
SSKHKYLQAVWELFHTELVFLYRQLFVLRDVYKEPLKRCQVEGCLLLVEPDLLFGNLDQL
CRISRTFCQSFLSLLSTVDKENWDCTQLVVDLFERFSKGPSTISAYQAYCINYKATMEYL
GSIRQKEERFTEFERICLADERCFRLQLEDLLIAPLQRITRLPILLREIHKRSEEEESKG
KVEKVIDTMTESLRSIDDSVQWLHNFERLQQLQTQVVWPNISDLEPKSYVPDFLRVALSR
QFCENLLAHPRRKLIHEGPLELVENGRTVDMYAFLFNDMFVLTKTKKCASKLKVKGVPIG
KSEHYIVQRQPVPLDSCVFCDADSNDQATPMSLKFAFVIIHLTRYYQVVGIYTLQAADKA
DKELWIEKFQESIENYESIQLKDMLKCTPLFSSLSLRRCSSSRLMSKSESNSPQLPKEKE
KEKEEKKECCSSSTCNNQAPP
Download sequence
Identical sequences Q9N2V4
Y95B8A.12 Y95B8A.12a NP_001032992.1.50509 Y95B8A.12a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]