SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZK287.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK287.2
Domain Number 1 Region: 485-601
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ZK287.2
Sequence length 611
Comment $ SECSG $ SQ44900 $ PDBT12713 $
Sequence
MKEVYQPCTTTDQDIVEKKECSPFRKKLQKYIPILEWLPNYQWKDHFHGDVIAGLTVGIM
HVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAP
DIPISNSSDINPSVYPLGEYVDPLVFTSALTLLVGVVQIIMGILRLGFLTTYLSDSLVSG
FTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGILFL
DLGRTYINPIVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVYEIPRGFPLPSIP
RLNFLPALLSDAIPIAVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVY
PVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSL
FMQVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPSFSTV
LHDETPRQNVPENVKIVKFAGSLHFANVTAFQDDMGEAIGKLPEEDPLIDERTIILDASS
VAFIDIMGVDALRDVFKDALKLGVHVFYCGLPEDVLSVLSNDENFLSVVPPSTFFPSIDS
CLISFVHQQSV
Download sequence
Identical sequences G5EFB2
NP_001256129.1.50509 ZK287.2 ZK287.2a 6239.ZK287.2.2 ZK287.2 ZK287.2a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]