SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hsk002100413.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hsk002100413.2
Domain Number 1 Region: 146-359
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 344-498
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 
Domain Number 3 Region: 48-162
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-21
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) hsk002100413.2
Sequence length 567
Comment $ RSGI $ SQ95307 $ PDBT233719 $
Sequence
AVANSRFDFIPRATEKKKKSQTETGKERERTSFLTQGGKRFELQHGLAVICMTLLITGDS
IVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQE
DEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGY
LKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQD
GFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKY
PLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEG
EDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMD
KYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFREERKMVQE
DEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQS
QVFEFTEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences hsk002100413.2 hsk002100413.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]