SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hsk002101230.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hsk002101230.1
Domain Number 1 Region: 1169-1391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-63
Family DBL homology domain (DH-domain) 0.0000000251
Further Details:      
 
Domain Number 2 Region: 1391-1531
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-30
Family Pleckstrin-homology domain (PH domain) 0.00000152
Further Details:      
 
Domain Number 3 Region: 1546-1666
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-28
Family PLC-like (P variant) 0.0044
Further Details:      
 
Domain Number 4 Region: 1083-1167
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-27
Family SH3-domain 0.00000321
Further Details:      
 
Domain Number 5 Region: 236-338
Classification Level Classification E-value
Superfamily EF-hand 4.42e-27
Family Eps15 homology domain (EH domain) 0.0028
Further Details:      
 
Domain Number 6 Region: 14-113
Classification Level Classification E-value
Superfamily EF-hand 6.15e-26
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 7 Region: 737-820
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-21
Family SH3-domain 0.00000526
Further Details:      
 
Domain Number 8 Region: 848-937
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-19
Family SH3-domain 0.0000161
Further Details:      
 
Domain Number 9 Region: 959-1020
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-19
Family SH3-domain 0.0000294
Further Details:      
 
Domain Number 10 Region: 1028-1098
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000108
Family SH3-domain 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) hsk002101230.1
Sequence length 1676
Comment $ RSGI $ SQ78936 $ PDBT233842 $
Sequence
QGKLRTMMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGL
PAPVLAEIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLIS
ARFGMGSMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASL
IQPLPIPYSSSTLPHGSSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTG
TSEWAVPQPTRLKYRQKFNTLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADVDGD
GQLKAEEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQEEE
PQKKLPVTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQ
EWKKQLELEKRLEKQRELERQREEERRKDIERREAAKQELERQRRLEWERIRRQELLNQK
NREQEEIVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEI
MEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQR
LKEQLDALEKETASKLSEMDSFNNQLKELRETYNTQQLALEQLYKIKRDKLKEIERKRLE
LMQKKKLEDEAARKAKQGKENLWKENLRKEEEEKQKRLQEEKTQEKIQEEERKAEEKQRK
DKDTLKAEEKKRETASVLVNYRALYPFEARNHDEMSFNSGDIIQVDEKTVGEPGWLYGSF
QGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSATSTSSEPLSSNQPASVTDYQN
VSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENLKAQALCSWTAKKDNHLNFSK
HDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREEPEALYAAVNKKPTSAAYS
VGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQES
FGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKK
RQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDD
PDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQTLDTMQPIERKRQGYIHELIQTE
ERYMADLQLVVEVFQKRMAESGFLTEGEMALIFVNWKELIMSNTKLLKALRVRKKTGGEK
MPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTDFKEFLKKLASDPRCKGM
PLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKLALERAEELCSQVNEGVREKEN
SDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKELHGFLFNDFLLL
TYMVKQFAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDEPVFHISHIDRV
YTLRTDNINERTAWVQKIKAASEQYIDTEKKQREKAYQARSQKTSGIGRLMVHVIEATEL
KACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQ
FSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTGEVWVRFDLQLFEQKTLL
Download sequence
Identical sequences hsk002001230.6 hsk002101230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]