SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hsk002301387.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hsk002301387.1
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-39
Family DBL homology domain (DH-domain) 0.0000888
Further Details:      
 
Domain Number 2 Region: 127-273
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 387-518
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.27e-32
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 290-404
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.83e-27
Family DEP domain 0.0037
Further Details:      
 
Domain Number 5 Region: 505-585
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000186
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 589-653
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000013
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) hsk002301387.1
Sequence length 1247
Comment $ RSGI $ SQ85823 $ PDBT233934 $
Sequence
LHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGG
RKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINET
KRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVY
CKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWK
IHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMM
MNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVS
DKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYK
SVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEE
MEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEVA
GLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLC
FQIRGAAPPYVYAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREE
ALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRLSLCEDSP
MVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVEN
CRRLMALSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPH
PLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQH
CITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYL
QLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDTSLAEEASSLPLVSEESEMDRSD
HGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGS
GDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQAI
HPFTHSATHAPINPSVHPPLHPTTHLPSIHPPTHPPTHPSIYPPTHPSIHLLVCPSIHPS
LLPSVCPLFHPSTHSFIIYLSIHASVHPVNNFPEPACARPCTGHWRP
Download sequence
Identical sequences hsk002301387.1 hsk002301387.2 hsk002301387.3 hsk002301387.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]