SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hsk003000264.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hsk003000264.2
Domain Number 1 Region: 187-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-51
Family DBL homology domain (DH-domain) 0.000000293
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-38
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 667-768,817-843
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 5 Region: 589-697
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000334
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 6 Region: 784-832
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000235
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) hsk003000264.2
Sequence length 847
Comment $ RSGI $ SQ128376 $ PDBT233970 $
Sequence
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKSKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
Download sequence
Identical sequences hsk003000264.2 hsk003000264.3 hso003006630.1 hso003006630.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]