SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hsk003000681.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hsk003000681.1
Domain Number 1 Region: 69-201
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 2 Region: 256-426
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-21
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 3 Region: 2-87
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-19
Family DBL homology domain (DH-domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) hsk003000681.1
Sequence length 468
Comment $ RSGI $ SQ95244 $ PDBT233994 $
Sequence
IIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPDSKDAQKSLELIAT
AAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKLSAKNGTTQDRYLI
LFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLVSGKQRSLELQART
EEEKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEV
TMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNRVCTDCYVALHGVP
GSSPACSQHTPQRRRSILEKQASVAAENSVICSFLHYMEKGGKGWHKAWFVVPENEPLVL
YIYGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWYFSPETEELQRRWM
AVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
Download sequence
Identical sequences hsk003000681.1 hsk003000681.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]