SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for hso002002623.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso002002623.1
Domain Number 1 Region: 5-110
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000356
Family Phosphotyrosine-binding domain (PTB) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) hso002002623.1
Sequence length 114
Comment $ RSGI $ SQ100229 $ PDBT234342 $
Sequence
MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI
RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAF
Download sequence
Identical sequences hso002002623.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]