SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for hso002002785.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso002002785.2
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily SH3-domain 1.16e-23
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) hso002002785.2
Sequence length 60
Comment $ RSGI $ SQ135300 $ PDBT234352 $
Sequence
PCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
Download sequence
Identical sequences d2dbma1 hso002002785.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]