SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hso003001114.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso003001114.1
Domain Number 1 Region: 976-1266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 218-417
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-51
Family DBL homology domain (DH-domain) 0.0000147
Further Details:      
 
Domain Number 3 Region: 418-535
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-31
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 4 Region: 805-966
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-24
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 625-688
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000316
Family SH3-domain 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) hso003001114.1
Sequence length 1289
Comment $ RSGI $ SQ126511 $ PDBT234378 $
Sequence
MKGGDRAYTRGPSLGWLFAKCCCCFPCRDAYSHSSSENGGKSESVANLQAQPSLNSIHSS
PGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGDETTPQGDS
ADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLLAARQASTEVPTAADLVN
AIEKLVKNKLSLEGSSYRGSLKDPAGCLNEGMAPPTPPKNPEEEQKAKALRGRMFVLNEL
VQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEKC
IQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAYFEEVKQEINQRLTLSDFLI
KPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGFEGTL
TAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKM
NYLVLEENVDNDPCKFALMNRETSERVVLQAANADIQQAWVQDINQVLETQRDFLNALQS
PIEYQRKERSTAVMRSQPARLPQASPRPYSSVPAGSEKPPKGSSYNPPLPPLKISTSNGS
PGFEYHQPGDKFEASKQNDLGGCNGTSSMAVIKDYYALKENEICVSQGEVVQVLAVNQQN
MCLVYQPASDHSPAAEGWVPGSILAPLTKATAAESSDGSIKKSCSWHTLRMRKRAEVENT
GKNEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNTSMGILNPNFIQEVAPEFLVPL
VDVTCLLGDTVILQCKVCGRPKPTITWKGPDQNILDTDNSSATYTVSSCDSGEITLKICN
LMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERSCTSVILRWLPPSSTGN
CTISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWGISLPSEPS
EFVRLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKKCIHKATRKDVAVKFVSK
KMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELMDDGRLLDYLMNHDELME
EKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVKLIDLEDAVQISGHFHI
HHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFLDESKEETCINVCRVDF
SFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPHNGSYSKIPLDTSRLAC
FIERRKHQNDVRPIPNVKSYIVNRVNQGT
Download sequence
Identical sequences hso003001114.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]