SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hso003007793.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso003007793.1
Domain Number 1 Region: 1378-1429,1475-1655
Classification Level Classification E-value
Superfamily VPS9 domain 5.36e-41
Family VPS9 domain 0.0021
Further Details:      
 
Domain Number 2 Region: 12-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.75e-37
Family Regulator of chromosome condensation RCC1 0.005
Further Details:      
 
Domain Number 3 Region: 519-687
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.28e-28
Family beta-lactamase inhibitor protein-II, BLIP-II 0.059
Further Details:      
 
Domain Number 4 Region: 1047-1136
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.75e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 5 Region: 1141-1249
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.22e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 927-1014
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000965
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 692-891
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000127
Family DBL homology domain (DH-domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) hso003007793.1
Sequence length 1657
Comment $ RSGI $ SQ135473 $ PDBT234501 $
Sequence
MDSKKRSSTEAEGSKERGLVHIWQAGSFPITPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGTLPWRSGPVEICPSSPILENALVGQYVITVATGSFHSGAVTDNGVAYMWGENSA
GQCAVANQQYVPEPNPVSIADSEASPLLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTAFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLTESQAENHASTALSPSTETLDRQEEVFENTLVANDQS
VATELNAVSAQITSSDAMSSQQNVMGTTEISSARNIPSYPDTQAVNEYLRKLSDHSVRED
SEHGEKPVPSQPLLEEAIPNLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKK
VMNFYSTTPCETGAQAGSSAIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEETEGGSR
RLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLG
HGDVLPRLQPLCVKCLDGKEVIHLEAGGYHSLALTAKSQVYSWGSNTFGQLGHSDFPTTV
PRLAKISSENGVWSIAAGRDYSLFLVDTEDFQPGLYYSGRQDPTEGDNLPENHSGSKTPV
LLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRPL
LSLENLGTTTTVQLLQEVASRFSKLCYLIGQHGASLSSFLHGVKEARSLVILKHSSLFLD
SYTEYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNTLFFLP
IRRLHNYAKVLLKLATCFEVASPEYQKLQDSSSCYECLALHLGRKRKEAEYTLGFWKTFP
GKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLW
AEPLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGMSDLPPYGSG
SSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVLKWPDGKMYSGMFRNGL
EDGYGEYRIPNKAMNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRS
GKLTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEG
NFHLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPNGDYIEGYFSGEWGSGIKIT
GTYFKPSLYESDKDRPKVFRKLGNLAVPADEKWKAVFDECWRQLGCEGPGQGEVWKAWDN
IAVALTTSRRQHRDSPEILSRSQTQTLESLEFIPQHVGAFSVEKYDDIRKYLIKACDTPL
HPLGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTI
PLSAPLPTERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDRE
EDIYWECVLRLNKQPDIALLGFLGVQRKFWPATLSILGESKKVLPTTKDACFASAVECLQ
QISTTFTPSDKLKVIQQTFEEISQSVLASLHEDFLWSMDDLFPVFLYVVLRARIRNLGSE
VHLIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences Q96Q42
9606.ENSP00000264276 ENSP00000264276 ENSP00000264276 NP_065970.2.87134 NP_065970.2.92137 XP_006712717.1.92137 gi|40316935|ref|NP_065970.2| ENSP00000264276 hso003007793.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]