SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hso003011180.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso003011180.1
Domain Number 1 Region: 494-678
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-53
Family DBL homology domain (DH-domain) 0.000000201
Further Details:      
 
Domain Number 2 Region: 686-815
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-35
Family Pleckstrin-homology domain (PH domain) 0.0000159
Further Details:      
 
Domain Number 3 Region: 183-321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000173
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  hso003011180.1
Domain Number - Region: 18-86
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000196
Family CRAL/TRIO domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) hso003011180.1
Sequence length 925
Comment $ RSGI $ SQ128377 $ PDBT234521 $
Sequence
MAEANPRRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMPKLPVVM
LSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELA
ETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHR
QISGDWQTINKLLTQVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQQLVTEVEFLLNQ
QAELADVTGTIAQVKQKIKKLENLDENSQELLSKAQFVILHGHKLAANHHYALDLICQRC
NELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQARQCCDEGECLLANQEIDKFQSKEDAQ
KALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAG
FRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQGKKTWRQNQSNLKIEVVPDCQEKRSS
GPSSSLDNGNSLDVLKNHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRN
KKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSET
IWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSALLKK
ALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFK
PMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVKGDNRKFEIWY
GEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQND
EKQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYF
YPTYDENEEENRPLMRPVSEMALLY
Download sequence
Identical sequences hso003011180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]