SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hso003013458.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso003013458.1
Domain Number 1 Region: 11-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-47
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 471-629
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.67e-17
Family Retroviral integrase, catalytic domain 0.045
Further Details:      
 
Domain Number 3 Region: 256-301
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000141
Family BAR domain 0.025
Further Details:      
 
Domain Number 4 Region: 353-453
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000394
Family Homeodomain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) hso003013458.1
Sequence length 782
Comment $ RSGI $ SQ128378 $ PDBT234588 $
Sequence
MAKHGADEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKV
YCASYDQALLLVDTYRKEPELQRHIQGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQ
KILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINT
HTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNVAAYLDNLQGA
VGFYHWLTPTQMIDGLALGESTPGPLIMVVAFVGFLAAYNHSLLGAEHQFIAVLQDVRDH
RITQVRAAEILNLSTRQITRLLQKLNQDGVSGLAHASRGQPGHHRHDELLKSKCLSIISE
HLLGFGPTLAHEKLSSIFDLNIPVETVRRWMMANDLWIPRSKRLKRPYQPRYNRDCFGEL
IQIDGSYHDWFEGRAAKCCLLVYIDDATGKLLHLRFCEAETTFDYMLSTRAYIEQYGKPL
AFYSDKHSVFRVNQKSRKDSQITQFGRILNELNIDIIFANSPQAKGRVERANRTLQDRLI
KEMRLEGISSIAEANAWLPCFIEHFNQKFAKCARNSKNLHRSLTESDAELEDIFTWQEPR
KVTKNLTITYDKCIYLLEPTELNHKLVGQYISFLEYPDGTVALMHEGRKINYSVFNKLAG
LQQNEVVENKRLGSVLAHIQQQHEELEKQNKRSRLKKSMPSRKAQKAVIEQRKLNPVLDS
CG
Download sequence
Identical sequences hso003013458.1 hso003013458.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]