SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for hso003013478.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  hso003013478.1
Domain Number 1 Region: 279-489
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-40
Family DBL homology domain (DH-domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 648-849
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-32
Family Pleckstrin-homology domain (PH domain) 0.0000765
Further Details:      
 
Domain Number 3 Region: 479-596
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-23
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) hso003013478.1
Sequence length 851
Comment $ RSGI $ SQ111225 $ PDBT234590 $
Sequence
MVDIPPPFDLACITKKPITKSSPSLLIESDSPDKYKKKKSSFKRFLALTFKKKTENKLHV
DVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPSSLIFYRDGKRK
GVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPP
RRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDAESAYTEPYKVC
PISSAAPKEDLTSDEEQRSSEEEDSASRDPSVTHKVEGQSRALVIAQELLSSEKAYVEML
QHLNLDFHGAVMRALDDMDHEGRDTLAREELRQGLSELPAIHDLHQGILEELEERLSNWE
SQQKVADVFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVREFEQSVQGGSQT
AKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDRANDSMEQGENL
QKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVLLYTYPQKDGKY
RLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGCLSRALPEDYK
AQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIV
CRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSFPLSSPRFSGSA
FSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHWKELWFVIKGKV
LYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQR
WIEAMEDASVL
Download sequence
Identical sequences hso003013478.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]