SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mmi002018667.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmi002018667.1
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mmi002018667.1
Sequence length 117
Comment $ RSGI $ SQ100252 $ PDBT235021 $
Sequence
LVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQEC
QDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPAPAGATVP
Download sequence
Identical sequences mmi002018667.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]