SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mmt007008935.3 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt007008935.3
Domain Number 1 Region: 13-116
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.29e-19
Family Canonical RBD 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mmt007008935.3
Sequence length 117
Comment $ RSGI $ SQ134550 $ PDBT235224 $
Sequence
KRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMV
EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRR
Download sequence
Identical sequences mmt007008935.3 d2e5ia1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]