SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mmt008007168.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt008007168.1
Domain Number 1 Region: 405-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-56
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 103-218
Classification Level Classification E-value
Superfamily BRCT domain 2.82e-19
Family DNA ligase 0.033
Further Details:      
 
Domain Number 3 Region: 234-323
Classification Level Classification E-value
Superfamily BRCT domain 1.09e-16
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mmt008007168.1
Sequence length 692
Comment $ RSGI $ SQ128400 $ PDBT235511 $
Sequence
MADDSVLPSPSEITSLADSSVFDSKVAEMSKENLCLASTSNVDEEMPQVEARVIMVQDAG
KQEELLKALKEMKVPCVKMDSMEEFESLDSPEFENIFVVTDFQNSVFNDLYKADCRIVGP
PVILNCAQRGEPLPFSCRPLYCTSMLNLVLCFTGFRKKEELVKLVTLVHHMGGVIRKECN
SKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQCFCAAVDDFRNEFKVPPF
QDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFV
VKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSLLSLSTPNSNRKRRRLKETLAQLS
RETDLSPFPPRKRPSAEHSLSIGSLLDISNTPESSIHYGETPKSCAKSSRSSTPVPPKQS
ARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDV
HMKIKDDLEDLIANWDESRSIGDIFLKYAKDLVKTYPPFVNFFEMSKEMIIKCEKQKPRF
HAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL
KEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETVSLGEHPCDRGEQ
VTLFLFNDCLEVNLYSLKFNTAVFCDLPNYLK
Download sequence
Identical sequences Q8C9Y7
mmt008007168.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]