SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mmt008011335.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt008011335.2
Domain Number 1 Region: 252-474
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-64
Family DBL homology domain (DH-domain) 0.00000000264
Further Details:      
 
Domain Number 2 Region: 474-614
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-33
Family Pleckstrin-homology domain (PH domain) 0.000000201
Further Details:      
 
Domain Number 3 Region: 628-748
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-26
Family PLC-like (P variant) 0.015
Further Details:      
 
Domain Number 4 Region: 175-257
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-26
Family SH3-domain 0.0000642
Further Details:      
 
Domain Number 5 Region: 32-94
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-19
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 6 Region: 108-178
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-18
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mmt008011335.2
Sequence length 755
Comment $ RSGI $ SQ111240 $ PDBT235518 $
Sequence
PHFRGPVRKSTSIDTGPTESPASLKRVASPAAKPAIPGEEFIAMYTYESSEQGDLTFQQG
DVIVVTKKDGDWWTGTGGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYA
ATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPT
ELPKTAVQPAVCQVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPS
NYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKP
LTESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHM
QPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYP
LIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLS
EQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFS
PKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKI
KAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMG
SQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQLSADDFLGRTEIRVADIK
KDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences Q8C4B5
mmt008011335.1 mmt008011335.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]