SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mmt010004614.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt010004614.2
Domain Number 1 Region: 405-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-56
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 104-218
Classification Level Classification E-value
Superfamily BRCT domain 4.36e-19
Family DNA ligase 0.033
Further Details:      
 
Domain Number 3 Region: 234-323
Classification Level Classification E-value
Superfamily BRCT domain 1.74e-16
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 4 Region: 617-762
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000533
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mmt010004614.2
Sequence length 882
Comment $ RSGI $ SQ107764 $ PDBT235527 $
Sequence
MADDSVLPSPSEITSLADSSVFDSKVAEMSKENLCLASTSNVDEEMPQVEARVIMVQDAG
KQEELLKALKEMKVPCVKMDSMEEFESLDSPEFENIFVVTDFQNSVFNDLYKADCRIVGP
PVILNCAQRGEPLPFSCRPLYCTSMLNLVLCFTGFRKKEELVKLVTLVHHMGGVIRKECN
SKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQCFCAAVDDFRNEFKVPPF
QDCILSFLGFSDEEKHSMEEMTEMQGGSYLPVGDERCTHLIVEENTVKDLPFEPSKKLFV
VKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSLLSLSTPNSNRKRRRLKETLAQLS
RETDLSPFPPRKRPSAEHSLSIGSLLDISNTPESSIHYGETPKSCAKSSRSSTPVPPKQS
ARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDV
HMKIKDDLEDLIANWDESRSIGDIFLKYAKDLVKTYPPFVNFFEMSKEMIIKCEKQKPRF
HAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL
KEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETVSLGEHPCDRGEQ
VTLFLFNDCLEIARKRHKVIGTFRSPHDRTRPPASLKHIHLMPLSQIKKVLDIRETEDCH
NAFALLVRPPTEQANVLLSFQMTSEELPKESWLKMLCRHVANTICKADAENLMYVADPES
FEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRMALSSSHSSEGRSPPSSGK
LAVSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRSTTHLI
Download sequence
Identical sequences NP_001171096.1.92730 NP_001171097.1.92730 ENSMUSP00000103933 ENSMUSP00000135740 mmt010004614.1 mmt010004614.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]