SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mmt010015432.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt010015432.1
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-55
Family DBL homology domain (DH-domain) 0.00000000203
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-46
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-34
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 636-765
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-25
Family SH2 domain 0.00065
Further Details:      
 
Domain Number 5 Region: 780-839
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-22
Family SH3-domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mmt010015432.1
Sequence length 845
Comment $ RSGI $ SQ135491 $ PDBT235535 $
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPQAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEDSALNDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRL
ESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNI
EELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDATEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLANYGRPKIDGELKITSVERRSKT
DRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDSSGERDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCYRCRAPAHKECLGRVPPCGRHGQDFAGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVH
GPPQDLSVHLWYAGPMERAGAEGILTNRSDGTYLVRQRVKDTAEFAISIKYNVEVKHIKI
MTSEGLYRITEKKAFRGLLELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAISKPPAGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEED
YSEYC
Download sequence
Identical sequences P27870 Q3U9E2
10090.ENSMUSP00000005889 mmt010015432.1 NP_035821.3.92730 ENSMUSP00000108491 ENSMUSP00000005889 ENSMUSP00000005889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]