SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mmt010019646.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt010019646.1
Domain Number 1 Region: 1145-1306
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-76
Family Pleckstrin-homology domain (PH domain) 0.0000000307
Further Details:      
 
Domain Number 2 Region: 941-1148
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.14e-51
Family DBL homology domain (DH-domain) 0.00000000596
Further Details:      
 
Domain Number 3 Region: 354-455
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 736-822
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000226
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  mmt010019646.1
Domain Number - Region: 675-712
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0517
Family Ras-binding domain, RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mmt010019646.1
Sequence length 1496
Comment $ RSGI $ SQ100547 $ PDBT235537 $
Sequence
MGLRPVSYTDSSVTPSVDGSIVLTAASVQSMPDSEESRLYGDDATYLAEGGRRQCPYTSN
GPTFMETASFKKKRSKSADIWREDSLEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGME
TEASPRQLSTCQRANSLGDLYAQKNSGVKANGGPRNRFSSYCRNLVSDIPDLAKHKMPPA
AAEETPPYSNYNTLPCRKSHCLSEGATNPQISLSKSMQGRRAKTTQDVNTGEGSEFADSG
IEGATTDTDLLSRRSNATNSSYSPPTGRAFVGSDSGSSSTGDAARQGVYENFRRELEMST
TNSESLEEAGSAHSDEQSSGTLSSPGQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVE
SATRRKWKHYWVSLKGCTLFFYETDGRSGIDHNSVPKHAVWVENSIVQAVPEHPKKDFVF
CLSNSLGDAFLFQTTSQTELENWITAIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKID
MDEKMKKMGEMQLSSVTDSKKKKTILDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPN
PKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTGEIGVRRRTQAMSRSASKRRSRFSS
LWGLDTTSKKKQGRPTINQVFGEGTDAVKRSLEGIFDDTVPDGKREKEVVLPSVHQHNPD
CDIWVHEYFTPSWFCLPNNQPALTVVRPGDTARDTLELICKTHQLDHSAHYLRLKFLMEN
RVQFYIPQPEEDIYELLYKEIEICPKVTQNIHIEKSDAAADNYGFLLSSVDEDGIRRLYV
NSVKETGLASKKGLKAGDEILEINNRAAGTLNSSMLKDFLSQPSLGLLVRTYPEPEGGVE
LLENPPHRVDGPVDLGESPLAFLTSNPGHSLSSEQGSSAETAPEEGEGPDLESSDETDHS
SKSTEQVAAFCRSLHEMSPSDSSPSPQDATSPQLATTRQLSDADKLRKVICELLETERTY
VKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKL
EKVDQFKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPR
QQHSSTLESYLIKPIQRVLKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQ
KIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFV
FKTAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAV
CEIVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHRRQLLKTESLPSAQQYV
PFGGKRLCALKGARPAMSRAVSAPSKSLGRRRRRLARNRFTIDSDAISASSPEKEPQQPA
GGGDTDRWVEEQFDLAQYEEQDDIKETDILSDDDEFCESLKGASVDRDLQEQLQAASISQ
RARGRRTLDSHASRMTQLKKQAALSGINGGLESASEEVIWVRREDFAPSRKLNTEI
Download sequence
Identical sequences Q3UHH6
mmt010019646.1 mmt010019646.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]