SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for rv1364c from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  rv1364c
Domain Number 1 Region: 559-630
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000149
Family Anti-sigma factor antagonist SpoIIaa 0.0026
Further Details:      
 
Domain Number 2 Region: 16-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000128
Family Heme-binding PAS domain 0.044
Further Details:      
 
Domain Number 3 Region: 426-522
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000356
Family Histidine kinase 0.017
Further Details:      
 
Weak hits

Sequence:  rv1364c
Domain Number - Region: 192-394
Classification Level Classification E-value
Superfamily PP2C-like 0.000217
Family PP2C-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) rv1364c
Sequence length 653
Comment $ XMTB $ SQ81220 $ PDBT241539 $
Sequence
MAAEMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAR
EVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDYDGSGVEERYFDFVVTPRRRADGSI
EGVQLIVDDVTSRVRARQAAEARVEELSERYRNVRDSATVMQQALLAASVPVVPGADIAA
EYLVAAEDTAAGGDWFDALALGDRLVLVVGDVVGHGVEAAAVMSQLRTALRMQISAGYTV
VEALEAVDRFHKQVPGSKSATMCVGSLDFTSGEFQYCTAGHPPPLLVTADASARYVEPTG
AGPLGSGTGFPVRSEVLNIGDAILFYTDGLIERPGRPLEASTAEFADLAASIASGSGGFV
LDAPARPIDRLCSDTLELLLRSTGYNDDVTLLAMQRRAPTPPLHITLDATINAARTVRAQ
LREWLAEIGADHSDIADIVHAISEFVENAVEHGYATDVSKGIVVAAALAGDGNVRASVID
RGQWKDHRDGARGRGRGLAMAEALVSEARIMHGAGGTTATLTHRLSRPARFVTDTMVRRA
AFQQTIDSEFVSLVESGRIVVRGDVDSTTAATLDRQIAVESRSGIAPVTIDLSAVTHLGS
AGVGALAAACDRARKQGTECVLVAPPGSPAHHVLSLVQLPVVGADTEDIFAQE
Download sequence
Identical sequences A0A0T9N9K1 A5U265 I6XXS7 P9WLZ7
419947.MRA_1373 83332.Rv1364c gi|57116853|ref|YP_177802.1| gi|148661154|ref|YP_001282677.1| rv1364c gi|57116853|ref|YP_177802.1| WP_003916806.1.11596 WP_003916806.1.11960 WP_003916806.1.16108 WP_003916806.1.16141 WP_003916806.1.26098 WP_003916806.1.28202 WP_003916806.1.29339 WP_003916806.1.29698 WP_003916806.1.30888 WP_003916806.1.34255 WP_003916806.1.39239 WP_003916806.1.40922 WP_003916806.1.47207 WP_003916806.1.48419 WP_003916806.1.50235 WP_003916806.1.53230 WP_003916806.1.59961 WP_003916806.1.62021 WP_003916806.1.6295 WP_003916806.1.67346 WP_003916806.1.68433 WP_003916806.1.68576 WP_003916806.1.71329 WP_003916806.1.75665 WP_003916806.1.78322 WP_003916806.1.83409 WP_003916806.1.83470 WP_003916806.1.8426 WP_003916806.1.84488 WP_003916806.1.85823 WP_003916806.1.91207 WP_003916806.1.9139 WP_003916806.1.93245 WP_003916806.1.9368 YP_177802.1.84033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]