SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for srz001000072.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  srz001000072.1
Domain Number 1 Region: 140-353
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-61
Family DBL homology domain (DH-domain) 0.0000000659
Further Details:      
 
Domain Number 2 Region: 338-474
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-44
Family Pleckstrin-homology domain (PH domain) 0.00000414
Further Details:      
 
Domain Number 3 Region: 46-164
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-23
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) srz001000072.1
Sequence length 475
Comment $ RSGI $ SQ156453 $ PDBT236206 $
Sequence
DGTCTGAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGGGGEQLAINELISDGSV
VCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQDE
PADDDAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYIKHLRDICEGYVRQCRK
RADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSELGACFLEHQADFQIYS
EYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFLLTPVQKICKYPLQLAE
LLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVR
SSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVD
LEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLD
Download sequence
Identical sequences srz001000072.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]